KEGG   Mycobacterium vanbaalenii: Mvan_3206Help
Entry
Mvan_3206         CDS       T00449                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mva02020]
Cellular Processes; Cell motility; Bacterial chemotaxis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3413655..3414431
Genome map
AA seq 258 aa AA seqDB search
MTVTSTDDPLRGVVAIGGSAAGVEALSRVAAGLPEDLPFAVLMALHLPEQGPSVLAQIID
RAGPLPAVAAENGATLEPGRIYVAVPGRHLLTRDHRIVLSNGPSESGHRPALNALFRSVA
VSFGPRAIGVLLSGVLDDGVLGLAAIRARGGTTLCQSPDDALFAAMPSNALRAGVVDRTA
VAADMGAVLMGLARRGSSGHAKSTDAYLELENHIAMTEPLAELDLQTLGPPSGFTCPDCN
GSLLTVADGYYRCHIGHA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgacgtcgactgacgatcctctgcgcggagttgtggcgatcggaggctccgca
gccggcgtggaagccctgtcgagagtcgccgcaggcctgcctgaggacctgccgttcgcg
gtgttgatggccctgcacctgcccgagcagggccctagcgtgctcgcgcagatcatcgat
cgggccggcccgctgcctgccgtggccgcagagaacggtgcgacgctggagcccggccgc
atctatgtggccgtccccggccggcacctgctcacccgcgatcaccgaatcgtgctgtcg
aacggcccgagcgagagcgggcaccgcccggcgctcaacgcgctgtttcgttctgtggca
gtctctttcgggccgcgagccatcggagtgctgctctccggtgtactcgacgacggggtg
ctgggcctggccgcgattcgggcgcggggtggcaccacgctgtgccagtcccccgacgac
gcgctgttcgccgccatgccgagtaatgcgctgcgcgcaggtgtcgtggaccgcaccgcc
gtcgccgcggacatgggggcggttctcatggggctcgcacggcgcggatcttcggggcat
gcgaagtcaactgacgcgtatctggagttggagaaccacatcgcgatgacggagccgctc
gccgagctggatctccagacccttggtccgccttcgggattcacctgtccggactgcaac
ggatcgcttctgaccgtcgccgacggctactaccggtgtcacatcggccacgcctga

DBGET integrated database retrieval system