KEGG   Mycobacterium vanbaalenii: Mvan_3206Help
Entry
Mvan_3206         CDS       T00449                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mva00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mvan_3206
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mvan_3206
Enzymes [BR:mva01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mvan_3206
Two-component system [BR:mva02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mvan_3206
Bacterial motility proteins [BR:mva02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mvan_3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3413655..3414431
Genome map
AA seq 258 aa AA seqDB search
MTVTSTDDPLRGVVAIGGSAAGVEALSRVAAGLPEDLPFAVLMALHLPEQGPSVLAQIID
RAGPLPAVAAENGATLEPGRIYVAVPGRHLLTRDHRIVLSNGPSESGHRPALNALFRSVA
VSFGPRAIGVLLSGVLDDGVLGLAAIRARGGTTLCQSPDDALFAAMPSNALRAGVVDRTA
VAADMGAVLMGLARRGSSGHAKSTDAYLELENHIAMTEPLAELDLQTLGPPSGFTCPDCN
GSLLTVADGYYRCHIGHA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgacgtcgactgacgatcctctgcgcggagttgtggcgatcggaggctccgca
gccggcgtggaagccctgtcgagagtcgccgcaggcctgcctgaggacctgccgttcgcg
gtgttgatggccctgcacctgcccgagcagggccctagcgtgctcgcgcagatcatcgat
cgggccggcccgctgcctgccgtggccgcagagaacggtgcgacgctggagcccggccgc
atctatgtggccgtccccggccggcacctgctcacccgcgatcaccgaatcgtgctgtcg
aacggcccgagcgagagcgggcaccgcccggcgctcaacgcgctgtttcgttctgtggca
gtctctttcgggccgcgagccatcggagtgctgctctccggtgtactcgacgacggggtg
ctgggcctggccgcgattcgggcgcggggtggcaccacgctgtgccagtcccccgacgac
gcgctgttcgccgccatgccgagtaatgcgctgcgcgcaggtgtcgtggaccgcaccgcc
gtcgccgcggacatgggggcggttctcatggggctcgcacggcgcggatcttcggggcat
gcgaagtcaactgacgcgtatctggagttggagaaccacatcgcgatgacggagccgctc
gccgagctggatctccagacccttggtccgccttcgggattcacctgtccggactgcaac
ggatcgcttctgaccgtcgccgacggctactaccggtgtcacatcggccacgcctga

DBGET integrated database retrieval system