KEGG   Mycobacterium vanbaalenii: Mvan_3280Help
Entry
Mvan_3280         CDS       T00449                                 

Definition
catechol O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mvan_3280
Enzymes [BR:mva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     Mvan_3280
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Mvan_3280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3487869..3488603
Genome map
AA seq 244 aa AA seqDB search
MNAIRRWARLALGMPSFVRTGQIGDGREAACAAYVEANAPRGDIDAALSAIDTFAYRKAM
LVNIGDEKGALLDAAVRRADPALVLELGTYCGYSALRIARAAPSARVLSVEFSAANADVA
RRIWAHAGVGDRVTCVVGTLGDGGRTLDTLAREHGVTTGSVDLLFIDHDKKAYLSDLRSV
EQRGWLHRGSIVVADNVRVPGAPDYRRHMREQQGTRWNTVEHKTHVEYQSLLPDLVLESE
YLGS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatccgacggtgggcccggttggcgctgggcatgccgtcgttcgtccggacc
gggcagatcggtgacggccgggaggctgcgtgcgcggcctacgtcgaggccaacgcccca
cgtggcgacatcgacgcggccctgtcggcgatcgacaccttcgcctaccggaaggcgatg
ctggtcaacatcggagacgagaagggcgcgctgctcgacgccgcggtgcgccgggccgat
cccgccctggtgctcgagctcgggacctactgcggctacagcgccctgcgcatcgcccgc
gcggcgccgtcggcgcgcgtgttgtcggtcgagttctccgccgcgaacgccgacgtcgca
cgccgcatctgggcccacgccggcgtcggcgaccgcgtcacctgcgtggtcgggaccctc
ggcgacggcggccgcacgctcgacaccctcgcccgcgagcacggcgtcaccaccggcagc
gtcgacctgctgttcatcgaccacgacaagaaggcctacctgtcggacctgcgcagcgtc
gaacagcgcgggtggctgcaccggggatcgatcgtcgtcgccgacaacgtccgggtgccg
ggcgctccggactaccggcgccacatgcgcgagcagcagggcacgcggtggaacaccgtg
gagcacaagacccacgtcgaataccagtcgctgctgcccgacctggtgctggagtccgag
tatctgggcagttag

DBGET integrated database retrieval system