KEGG   Mycobacterium vanbaalenii: Mvan_3505Help
Entry
Mvan_3505         CDS       T00449                                 

Definition
chitinase, cellulase (EC:3.2.1.14 3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
K01183  
chitinase [EC:3.2.1.14]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mvan_3505
   00520 Amino sugar and nucleotide sugar metabolism
    Mvan_3505
Enzymes [BR:mva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mvan_3505
    3.2.1.14  chitinase
     Mvan_3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3723963..3730880)
Genome map
AA seq 2305 aa AA seqDB search
MGYGRFVGRVGALAVALGIGLAVPAVAAADPTDDSTAGESSAKADQSDAAGVGSQDPGDT
SSETDDVGSEDADSDDPDAEESDDLAEHGSPEGDDEDTATPPGEVAAEPPADDATPAAEP
NDESQQADRHQAHSPVDEETDGDADPEADGLDTGPEPTDAPAGHRGADEAVTPDAAPPAV
EPATPTMAVSVSSAAAETDTATASTGLASIVSKFLGVLGIGPSAANGAVPLPAFEFVTAV
FGAIRREMDRLFANHGPTAALAWSSQPAPGLITGTLTASDPEGDRLVYTVVQAPTKGTVT
VDASGNFTYTVNPLLASAAGTDSFVIQVRDAGFHLISVSPTKTRVPVAITVDSGGVVTKT
TSARSGATALAATSAATGTIHHVVTSGPDIVGFDPARDKLDLGDVSVHNFIVVDTAEGVG
FRNPWSGETAVVKGVSLSQLTVDSFTPVINDHLRQDLSGALAWESGVTPQPDTVYARSHE
VGQIDRVAFDAATDVVDFRYFGTREQVYMSDTPEGVVISNAGTGQALILQGVTKSQLTAS
NFIFHNAQVREDRLNQQLGIGAVSDSQILPQGVPVAGTDSWPTAAGDGQPPAGETGTTTT
ISWQYGRHATLDFDPSTDKLDFGWFKAHEFDVTEVAGSTRIAITGNNQSYTLTGVAIGEL
QTSNIVALDDGARTKWSNLIYSAGQSVSQPSLSVSDGSVSEGNSGTSTVNFTVTLSKAST
ETVTVSYSTSNGTATAAGGDYAPAVGTLTFAPGQTTKAVTVTVNGDTLVELDEQFTLTLS
SPLNATIADGSGVGTIRNDDIDQAPATPPTVSIADLSVTEGNGDHSHFMFVATLNKASTE
TVTVSYATSNGTAIAGLDYSATSGTITFAPGVTSQLVHVDVVGDALAETSETFLVTLSSP
TAATIGDGSATGTILDDDTVVPGTGGVNSGNPGDALWGEAYFAPYVDMGAWPVPDLLAIA
RNYGTSLITLGFLQATPDGKLAWAGLSALTPDSDFDQAKAINQSIAALQAAGGDVMISLG
GASGTSLAQWYVTRGLSAQALATAYAGIVDTYHLNRIDFDIEGAAVADQASIALNAQALK
LLQQQKPDLEIWYTLPVLPTGLTADGLNVVRAALTTGVKLDGVNVMAMDYGESAAPTSGP
NAKTMGAYAIQAAESTHAQLSALYTQHGQSFGWNQLGVTPMIGVNDVLTEVFTVADAQAL
EDFARAKDLGMLSMWSVNRDKPGNLGQATTNTSGTNAPEGSFSNVFNDYGTVNPVSGPPP
VISIADLAVAEGNGDHAHFMFVVTLDRASTEAVTVHYTTANGTATAGVDYTAASGVIEFA
PGVTSRTVHVDILGDTLAESSETLTVTLSSPTGATIADGTATGTITDDDGGTTPTPVDSS
VKYVVNDNWGSGFVATVIVTAGTSGFSGWTVEFDSPAQISNIWNAEIVSQVGNHYVVRNV
SWNPKVVAGQTVEFGFQASPGGATATATGFVVNGVPAGGQGPAPVVLPKVAIADASVTES
DSGTKNMVFVVTLDKAPATPVSIAYATSNGTATAGSDFTATSGVLTFAAGATTAQITVPI
LGDTVVEQNETFTLTLSNPNGVTIADASAVGTVTNDDVATPTPGNSSATLAVNDNWGSGF
TATVTVTAGSAGLNGWTVEFDTPAQISNIWNAEIVSRVGNHYVVRNASWNPKVAANQTVS
FGFQASPGGASATATNFVVNGQASAPVQPTVSVADAAVNEAHSGATQMTFVVTLSKASTT
PVTVTYATGNGTATAGVDYTAKSGTVTFAPGVLSQQIQVSITGDTAVEANETFTLTLSNP
SGATVSDGSATGTITNDDVAVPGNVSLSISDASVTEGVPGTGVAAGWFKTAGNQIVDSAG
NPVQIAGVNWFGMESDIFTPHGLWTRNYKDMMNQMAALDFNTIRLAYSSESLHTTKAPSG
IDFSKNPDLVGLSSLQIMDKIVAYAGEIGMRVILDHHRSSAGAGPNGNGLWYEGSYTEAA
WIADWKMLAQRYANDPTVIGADLHNEPHNGTWGGGGATDWAAAAERAGNAVLSVNSNWLI
FVEGVETYQGNNYWWGGNLMGVKDRPIVLNVPDRVVYSPHDYPNSVYNQPWFQTANFGAA
LPDKFEQMWGYIYEQNIAPIYLGEFGTRMTDPKDLVWYEAITSYLSGDFDNNGTIDIAAG
TEDMSWTFWSWNPNSTDTGGILADDWNTVNTNKMAYLQAIQFDFDEGSPGVLAQFVVSLA
APSTQAVTVQYATSNGTATGGSDFAATSGTLTFQPGETSKTITVVVFGDTLMEGNESFVV
TLSSPAGATIADPTGAGTIVDRVIV
NT seq 6918 nt NT seq  +upstreamnt  +downstreamnt
atgggttacggacgatttgttggtcgtgtcggtgcattagctgtggcgctgggcatcggg
ctcgcggtccccgccgtggcggccgccgacccgaccgacgacagcaccgcaggcgagtcg
agcgcgaaggctgaccagtccgacgccgccggcgtcggcagtcaagacccgggggatacc
tcgtcggagaccgacgacgtgggctcggaggatgcagactccgacgatcccgacgccgag
gaatctgacgacctggcggagcacggttcgcccgagggagacgacgaggacaccgcgact
ccgccgggagaagtagcggccgagccgcctgcagacgatgcgacgccggctgccgaaccg
aacgatgagtcgcagcaggccgatcgccaccaggcgcactcgcccgtcgacgaggaaacc
gacggggacgccgacccggaagccgacggtctcgacaccggccccgagcccacggacgcg
ccggccggccaccgcggtgccgacgaggccgtcacgccggatgctgccccaccggcagtc
gagcccgccaccccgacgatggccgtgtcggtctcgtctgcagcagccgagaccgacacc
gcgaccgcgtccaccgggctggcgagcatcgtctcgaagttcctgggtgtgctgggaatc
ggtccgtccgcggccaacggcgccgtgccgttgccggcgttcgagttcgtcaccgcggtg
ttcggcgcgatccgccgcgagatggaccgactcttcgccaaccacgggccgaccgccgcg
ctcgcgtggtccagccagccggcgcccggcctgatcaccggaacgctgaccgcctccgat
ccggaaggtgaccgactggtctacacggtggtgcaggcgccgaccaagggcaccgtgacc
gtcgacgcctcaggcaacttcacctacacggtcaacccgctgctggcttcggccgccggc
accgacagcttcgtcattcaggttcgcgacgccggattccacctgatctcggtgagtccc
accaagactcgggtccccgtggcgatcaccgtggactccggcggcgtggtcaccaagacg
acgtctgcgcgcagcggcgccaccgcactcgcggccaccagcgccgcgacgggcacgatc
caccacgtcgtcacatccgggcccgacatcgtcggattcgatcctgccagagacaaattg
gatctcggcgatgtgtcggtgcacaacttcatcgtcgtcgacacggccgagggggtcggc
ttccgcaacccctggtccggcgagaccgctgtcgtcaagggtgtgtctctgagccagctc
accgtcgacagcttcactccggtcatcaacgatcatctccgccaggacctttccggcgcg
ctcgcctgggagagtggtgtcaccccgcagcccgacaccgtctatgcacggtcccacgaa
gtcggacagatcgacagggtggccttcgatgcggccaccgatgtggtcgacttccgctat
ttcggcacccgcgaacaggtgtacatgtccgacacccccgagggcgtggtgatctccaac
gccggcaccggtcaggccctgatcctgcaaggtgtcaccaagagccagctcaccgcgagc
aatttcatcttccacaatgcccaggtgcgcgaagaccggctcaaccagcagctgggtatc
ggagcggtgtcggactcgcagatcctgccccagggtgttccggtggcgggtaccgacagc
tggcccaccgccgcgggtgacggccagccgcccgccggcgaaaccggcaccaccacaacg
atttcctggcagtacggacgtcacgccacgctcgacttcgacccgtccacggataagctc
gacttcggctggttcaaggcccacgagttcgacgtcaccgaggtcgccggctccacccgc
atcgcgatcaccggaaacaaccagtcgtacaccctcaccggtgtggccatcggcgagctg
cagacgagcaacatcgtcgcgctcgacgacggtgcgcggaccaagtggagcaacctcatc
tacagtgcggggcagtctgtttcgcagccgagcctgtcggtcagcgacggcagcgtgtcc
gaggggaactccgggacgtcgacggtgaacttcaccgtcacgctgtcgaaggcgtccacc
gagacggtcacggtcagctacagcacgagcaacggcaccgccaccgcggcaggcggcgac
tatgccccggcggtcggcacgctcacgttcgcgcccggacagacgaccaaggccgtcacg
gtcacggtcaacggcgacaccctcgtcgaactcgacgagcagttcacgctgacgctgtcc
tccccgctgaacgcgaccatcgccgacggcagcggagtcggcaccatccgcaacgacgac
atcgaccaggcgcctgccacgccgccgaccgtttccatcgccgacctgtccgtcaccgaa
ggcaacggcgatcacagccatttcatgttcgtcgcgaccctgaacaaggcgtcgacggag
acggtgaccgtcagctacgccacctccaacggcaccgcgatcgccggcctcgactacagc
gcgacctcgggcaccatcacctttgcacccggcgtgacctcgcaactggtacacgtcgac
gtcgtgggggatgcgctcgccgagacgagcgagacgttcctcgtcacgctgtcgagcccg
acagccgccaccatcggtgacggttcggcgaccgggacgatcctcgacgacgacaccgtg
gtgcccggcaccggcggcgtcaactccggtaaccccggcgacgccctctggggcgaggcg
tatttcgcgccctacgtcgacatgggtgcgtggccggtgccggatctgctggccatcgcc
cggaattacggcacgtcgctgatcaccctcggtttcctgcaggcgacgccggacggcaag
ctggcgtgggccgggctgtcggcgctgaccccggactccgacttcgaccaggccaaggcg
atcaaccagtcgatcgcggcgctgcaggccgcaggcggcgacgtgatgatctccctgggc
ggggcgtcgggaaccagcctggcgcagtggtacgtcacccgtgggctcagcgcgcaggca
ctggcaaccgcatacgccggcatcgtcgacacctaccacctcaaccgcatcgacttcgac
atcgaaggtgccgcggtggccgaccaggcgtcgatcgcgctgaacgcccaggcgctgaaa
ctgctgcaacagcagaagcccgacctggagatctggtacaccctgccggtgctgcccacc
ggcttgacggccgacggcctcaacgtcgtgcgcgccgcgctgacgacgggtgtcaagctc
gacggcgtcaacgtgatggcgatggactacggcgagtcggctgcgcccaccagcgggccg
aacgcaaagaccatgggcgcctacgccatccaggccgcggagtcgacccacgcgcagctc
tccgcgctctacacccagcatgggcagagcttcggctggaaccagctcggcgtcaccccg
atgatcggcgtcaacgacgttctgaccgaggtgttcaccgtcgccgatgcgcaggcactc
gaagacttcgcccgcgcaaaggatctcggcatgctgtcgatgtggtcggtgaaccgcgac
aaaccgggcaatctcggccaggccaccaccaacacctccgggaccaacgcccccgagggc
agcttcagcaacgtcttcaacgactacggaactgtcaatccggtgtccggaccgccgccg
gtgatctccatcgccgacctcgcggtggccgaaggcaacggcgatcacgcccatttcatg
ttcgtcgtgaccctggacagggcgtccaccgaggcggtcacggtgcactacaccacagcc
aacggcaccgcgaccgccggcgtggactacaccgcagcctcgggcgtcatcgagttcgcg
ccgggcgtcacgtcgcgcaccgtgcacgtcgacatcctcggcgacacccttgccgaatcg
agcgagacgctcaccgtgacgctgtcgagtccgaccggtgcgaccatcgccgacggcacc
gccaccggcaccatcaccgacgacgacggtggtaccaccccgaccccggttgactcgtcg
gtgaagtacgtcgtcaacgacaactggggatccggcttcgttgcgacggtcatcgtgacc
gcggggacgtccggattctcaggctggacagtggaattcgattcgccggcacagatcagc
aacatctggaacgcggagatcgtcagccaggtgggcaaccactacgtggtgcgcaacgtc
tcgtggaaccccaaggtcgtcgccgggcagaccgtcgagttcggcttccaggcgtcccct
ggcggcgccacggcgacggccaccggcttcgtcgtcaacggcgtgcccgccggtggtcag
ggtccggccccggtggtgttgccgaaggtcgcgatcgccgacgccagtgtcaccgaatcc
gacagcggcacaaagaacatggtgttcgtggtgacgttggacaaggcgccggcgacgccg
gtgagcatcgcctatgcgacgtcgaacggcaccgcgaccgccggaagtgacttcaccgcg
acctcgggtgttctgaccttcgccgccggtgcgaccaccgcgcagatcacggtcccgatc
ctgggcgacacggtcgtcgaacagaacgagacgttcacgctgaccctttcgaatccgaac
ggggtgaccatcgccgacgcttccgcggtcggcaccgtcaccaacgacgacgtggccacc
cccacgccgggcaattcgtcggccacgttggcggtcaacgacaattggggctccggcttc
accgctaccgtcaccgtgacagccgggtctgccggactcaacggctggacagtcgaattc
gacacccctgcgcagatcagcaacatctggaacgccgagatcgtgagcagggtcggcaac
cactacgtggtgcgcaacgcctcctggaaccccaaggtcgcggcgaaccagaccgtcagc
ttcggctttcaggcatctccaggaggtgcttcggcgacggccaccaacttcgtcgtcaac
ggacaggcgtcggcccctgtgcagccgacggtgtcggtcgccgatgccgcagtcaacgaa
gcacacagcggcgcaacgcagatgacgttcgtggtgacactgtcgaaggcgtcgaccacg
ccggtaaccgtcacctacgcgaccggcaacggtacggccaccgccggcgtggactacacc
gcgaagtcggggacggtgaccttcgccccgggagtgctctcgcagcagatccaggtctcc
atcaccggtgacaccgcggtcgaggcgaacgagaccttcacgctgacactctcgaacccc
agcggcgcgaccgtgtccgacggctccgccaccgggacaatcaccaacgacgacgtcgcg
gtgcccggcaacgtgtcgctgagcatctcggatgcctcggtgaccgaaggcgtgcccggc
accggggtcgcggccggctggttcaagaccgccggcaaccagatcgtcgattcggcgggc
aacccggtacagatcgccggcgtcaactggttcggcatggagagtgacatattcacgccg
cacggcctgtggacgcgcaactacaaagacatgatgaaccagatggcggcgctggacttc
aacaccatccggctcgcgtactccagcgagagcctgcacaccaccaaggcgccgtccggc
atcgacttctcgaagaatcccgacctggtcgggctcagctcgctgcagatcatggacaag
atcgtcgcgtacgccggcgaaatcgggatgcgtgtcatcctggaccaccatcgcagcagt
gcaggagcgggcccgaacggcaacggcctctggtacgagggctcctacaccgaggcggcg
tggatcgccgactggaagatgctggcgcagcggtatgccaacgatccgacggtgatcggt
gccgacctgcacaacgaaccgcacaatggaacctggggcggtgggggagccaccgactgg
gccgccgctgccgagcgggcgggcaacgccgtgctctcggtgaactcgaactggctgatc
ttcgtggagggcgtggaaacctatcagggcaacaactactggtggggtggcaacctgatg
ggtgtcaaggaccgcccgatcgtgttgaacgtgcccgaccgggtggtgtactcaccgcac
gactacccgaactcggtgtacaaccagccgtggttccagaccgccaacttcggtgcggcg
ctgccggacaagttcgagcagatgtggggctacatctacgagcagaacatcgcaccgatc
tacctcggcgagttcggcaccaggatgaccgacccgaaggacctcgtctggtacgaggcg
atcacgtcgtatctgtccggcgacttcgacaacaacggcaccatcgacatcgcggccggc
accgaggacatgtcgtggacgttctggtcgtggaacccgaattccactgacaccggcggg
atcctggccgacgactggaacacggtcaacacgaacaagatggcctacctgcaggccatc
cagttcgacttcgacgaaggcagccccggtgtgctggcgcagttcgtggtgtcgctggcc
gccccgtcgacccaggccgtgacggtccagtacgcgacgtcgaacggcaccgccaccggg
ggcagcgacttcgctgccacctcgggcacgctgacattccagcccggggagaccagcaag
acgatcaccgtggtggtgttcggggacaccctgatggaaggcaacgagagcttcgtcgtc
acactgtccagtccggccggggcgacgatcgccgacccgaccggtgccggcaccatcgtc
gaccgggtgatcgtctag

DBGET integrated database retrieval system