KEGG   Mycobacterium vanbaalenii: Mvan_3577Help
Entry
Mvan_3577         CDS       T00449                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mva00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mva00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mva02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3804738..3806051)
Genome map
AA seq 437 aa AA seqDB search
MPAVHNASVKCAAVAAASLLVLAGCGSSDDNQPKNPSVIILSGDGMGPQQRTAIQYYLYG
LDERQPMDALPYSGFLDTIPGDPEYAVTDSAAGATAWAIGQKVPNGTTGLGPDGESVPTL
LDLAQKRGMATGLVNDHDVTNATLAAFGSPVPDRDLKVDIARGYLDRGVDVLFGGGEKYW
YPEGDPGRIPDAGEDDASEGDEDLVARAQSDGYQYAYDQPTFDALTGPKALALVQDSAKR
RSTEIEGYDYSSDPNYVAPERLVSKALEILGTNENGFFLVIESDDLDSDGHEHDAQNMML
AGESVNNMVKVITEYQKDHPEVLLIVTADHETGGMTIENVLDDGEPEPNSDQVADDPVPY
WAEIPENMPLPGGGVPKRSGPFPIKGTDREFKVDWTTPEHTGTMVPVTAAGPLAERFTGV
HPNTYVYDVVTELWGDQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgttcataacgcgtccgtcaaatgcgccgccgttgcggccgcctccctgttg
gtgctcgcggggtgcggcagcagcgacgacaatcagccgaagaacccgagcgtcatcatc
ctcagcggggacggtatgggcccgcagcagcgcacagcgatccagtactacctgtacggg
ctcgacgagcgtcagccgatggatgcgctgccgtactccggcttcctggacacgattccc
ggcgaccccgagtacgcggtgacggactcggcggccggagccaccgcctgggcgatcgga
cagaaggtccccaacggcacgacagggctggggcccgacggagagtcagtgcccaccttg
ctcgatctggcccagaagcgcggcatggcaaccggtctggtcaacgaccacgacgtcacc
aacgcaacactggccgccttcggctcgccggtacccgaccgcgacctcaaggtcgacatc
gccaggggctacctcgatcgtggcgtcgacgtgctgttcggcggcggtgagaagtactgg
tacccggagggtgaccccggccggattcccgacgcgggcgaggacgacgccagtgagggg
gacgaggacctggtggcccgcgcacagtcggacggctaccaatacgcctacgaccagccg
acgttcgacgcgttgacaggcccgaaagcccttgcgctggtgcaggacagtgccaagcgc
cggtccaccgagatcgaagggtacgactacagcagcgacccgaactacgtcgctcccgag
cgcttggtgtccaaggcgctcgaaatcctcggcaccaacgagaacggcttctttctcgtc
atcgaaagcgatgacctggactccgacgggcatgagcacgacgcgcagaacatgatgctg
gccggagagtccgtcaacaacatggtcaaggtgatcaccgagtatcagaaggatcatccc
gaagtgctgttgatcgtgacggccgatcacgagaccggcggtatgacgatcgagaacgtc
ctcgacgacggtgaacccgaacccaacagcgatcaggtcgctgatgatccggtgccgtac
tgggccgagatccccgagaacatgccgttgcccggcggtggggtgcccaagcgcagcggc
ccgttcccgatcaagggcaccgatcgggagttcaaggtcgactggaccaccccggagcac
accggcacgatggtgccggtcaccgctgccggaccactggccgaacggttcaccggcgtg
caccccaacacctacgtctacgacgtcgtcaccgaactgtggggcgaccagtag

DBGET integrated database retrieval system