KEGG   Mycobacterium vanbaalenii: Mvan_3579Help
Entry
Mvan_3579         CDS       T00449                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_3579
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mvan_3579
  Amino acid metabolism
   00310 Lysine degradation
    Mvan_3579
Enzymes [BR:mva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mvan_3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3806645..3808387
Genome map
AA seq 580 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPAAGVLKKIV
AQEDDTVEVGGELAVIGDADDSDAGGDEKPEPEPEPEPEAEAEPEPAPEPEPEPEAKPKA
KPAQSSGSATPVLMPELGESVTEGTVTRWLKKVGDSVDVDEPLVEVSTDKVDTEIPSPVA
GTLLSITAEEDDTVEVGGELAKIGDAGAEAAPEPEPEPEPQPEPEPKTTTPSAKPAEEAA
PEPKPEPTPQPKPEPAPAAAAESSGDSSPYVTPLVRKLAGEHSVDLASVKGTGVGGRIRK
QDVLAAAEASKAPKEAPKAAPAAEAPAKVPTPAPEGALAHLRGTTQKANRIRQITAKKTR
ESLQTTAQLTQVHEVDMTKIVALRAKAKAKFAEREGVNLTYLPFIARAVIDALKIHPNVN
ASYNEDSKEITYYDAEHLGVAVDTEQGLLSPVIHNAGDLSLGGLARAISDIAARARSGDL
KPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDDYGNESIGVRS
VSYLPLTYDHRLIDGADAGRFVTTIKRRLEEGAFEADLGL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgtccagatgcccgcactcggagagagcgttaccgaggggacagtcacc
cgctggctgaagcaagagggagacacggtcgaggaggacgagccgttgctggaggtgtca
accgacaaggtcgacaccgagatcccctcacccgccgcgggtgtgctgaagaagatcgtc
gcccaggaagacgacaccgtcgaggtcggtggtgaactggccgtgatcggtgacgccgac
gacagcgacgccggcggcgacgagaagcccgagcctgagccggaacccgagcccgaggcg
gaagccgaaccggaacccgcaccggaaccggaacccgagccggaggccaagcccaaggcg
aagcccgcccagtcgtccggttcggccacgccggtgctgatgcccgagctgggtgagtcg
gtcaccgaggggaccgtcacccgctggctcaagaaggtcggcgacagcgtcgacgtcgat
gagccgctcgtggaggtgtcgacggacaaggtcgacaccgagatcccgtcgccggtagcg
ggcaccctgctgtcgatcaccgccgaggaagacgacaccgtcgaggtcggaggcgagctg
gccaagatcggcgacgccggggccgaagccgcccccgagcccgaacccgagccagagccc
cagcccgaaccggaacccaagacgaccacaccgtcggccaagcccgccgaggaagctgcg
cccgagcccaagccggaacccacgccccagccgaagccggagcctgcgcccgccgcggcc
gcggagtcctcgggtgattccagcccgtacgtgacaccgctggtgcgcaagctggccggt
gagcacagcgtcgatctggcgtcggtcaagggcaccggcgtcggcggacggatccgcaag
caggatgtgctggccgcagcggaggcgagcaaagcgccgaaggaggccccgaaggccgcg
ccggcggccgaggcccccgccaaggttcccacgcctgcgcccgaaggcgcgttggcgcac
ctgcgcggaaccacgcagaaggccaaccggattcgtcagatcaccgcgaagaagacccgg
gaatcgctgcagaccactgcgcagctgacccaggtccacgaggtcgacatgaccaagatc
gtggcgctgcgggccaaggccaaggccaagttcgccgaacgtgaaggcgtcaacctgacc
tacctgccgttcatcgcgcgggcggtgatcgacgcgttgaagatccacccgaacgtcaac
gccagctacaacgaggactccaaggagatcacctactacgacgccgaacacctcggcgtc
gccgtcgacaccgagcagggtctgctgtcgccggtgatccacaacgccggcgacctgtcg
ctgggtggtctggcgcgggcgatctccgatatcgcggcgcgggcacggtcgggcgacctc
aagcccgacgagctgtccggcggcacgttcacgatcaccaacatcggcagccagggcgca
ctgttcgacaccccgattctggtaccgccacaggcggcgatgctgggcaccggcgccatc
gtcaagagaccgagggtcatcgtcgacgactacggcaacgagtcgatcggtgtgcggtcg
gtgagctacctgccgttgacctacgaccaccgcctcatcgacggcgccgacgccggacgc
ttcgtcacgacgatcaagcgccgtctggaagagggcgccttcgaggccgacctggggctc
tag

DBGET integrated database retrieval system