KEGG   Mycobacterium vanbaalenii: Mvan_3579Help
Entry
Mvan_3579         CDS       T00449                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_3579
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mvan_3579
  Amino acid metabolism
   00310 Lysine degradation
    Mvan_3579
Enzymes [BR:mva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mvan_3579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3806645..3808387
Genome map
AA seq 580 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPAAGVLKKIV
AQEDDTVEVGGELAVIGDADDSDAGGDEKPEPEPEPEPEAEAEPEPAPEPEPEPEAKPKA
KPAQSSGSATPVLMPELGESVTEGTVTRWLKKVGDSVDVDEPLVEVSTDKVDTEIPSPVA
GTLLSITAEEDDTVEVGGELAKIGDAGAEAAPEPEPEPEPQPEPEPKTTTPSAKPAEEAA
PEPKPEPTPQPKPEPAPAAAAESSGDSSPYVTPLVRKLAGEHSVDLASVKGTGVGGRIRK
QDVLAAAEASKAPKEAPKAAPAAEAPAKVPTPAPEGALAHLRGTTQKANRIRQITAKKTR
ESLQTTAQLTQVHEVDMTKIVALRAKAKAKFAEREGVNLTYLPFIARAVIDALKIHPNVN
ASYNEDSKEITYYDAEHLGVAVDTEQGLLSPVIHNAGDLSLGGLARAISDIAARARSGDL
KPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDDYGNESIGVRS
VSYLPLTYDHRLIDGADAGRFVTTIKRRLEEGAFEADLGL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgtccagatgcccgcactcggagagagcgttaccgaggggacagtcacc
cgctggctgaagcaagagggagacacggtcgaggaggacgagccgttgctggaggtgtca
accgacaaggtcgacaccgagatcccctcacccgccgcgggtgtgctgaagaagatcgtc
gcccaggaagacgacaccgtcgaggtcggtggtgaactggccgtgatcggtgacgccgac
gacagcgacgccggcggcgacgagaagcccgagcctgagccggaacccgagcccgaggcg
gaagccgaaccggaacccgcaccggaaccggaacccgagccggaggccaagcccaaggcg
aagcccgcccagtcgtccggttcggccacgccggtgctgatgcccgagctgggtgagtcg
gtcaccgaggggaccgtcacccgctggctcaagaaggtcggcgacagcgtcgacgtcgat
gagccgctcgtggaggtgtcgacggacaaggtcgacaccgagatcccgtcgccggtagcg
ggcaccctgctgtcgatcaccgccgaggaagacgacaccgtcgaggtcggaggcgagctg
gccaagatcggcgacgccggggccgaagccgcccccgagcccgaacccgagccagagccc
cagcccgaaccggaacccaagacgaccacaccgtcggccaagcccgccgaggaagctgcg
cccgagcccaagccggaacccacgccccagccgaagccggagcctgcgcccgccgcggcc
gcggagtcctcgggtgattccagcccgtacgtgacaccgctggtgcgcaagctggccggt
gagcacagcgtcgatctggcgtcggtcaagggcaccggcgtcggcggacggatccgcaag
caggatgtgctggccgcagcggaggcgagcaaagcgccgaaggaggccccgaaggccgcg
ccggcggccgaggcccccgccaaggttcccacgcctgcgcccgaaggcgcgttggcgcac
ctgcgcggaaccacgcagaaggccaaccggattcgtcagatcaccgcgaagaagacccgg
gaatcgctgcagaccactgcgcagctgacccaggtccacgaggtcgacatgaccaagatc
gtggcgctgcgggccaaggccaaggccaagttcgccgaacgtgaaggcgtcaacctgacc
tacctgccgttcatcgcgcgggcggtgatcgacgcgttgaagatccacccgaacgtcaac
gccagctacaacgaggactccaaggagatcacctactacgacgccgaacacctcggcgtc
gccgtcgacaccgagcagggtctgctgtcgccggtgatccacaacgccggcgacctgtcg
ctgggtggtctggcgcgggcgatctccgatatcgcggcgcgggcacggtcgggcgacctc
aagcccgacgagctgtccggcggcacgttcacgatcaccaacatcggcagccagggcgca
ctgttcgacaccccgattctggtaccgccacaggcggcgatgctgggcaccggcgccatc
gtcaagagaccgagggtcatcgtcgacgactacggcaacgagtcgatcggtgtgcggtcg
gtgagctacctgccgttgacctacgaccaccgcctcatcgacggcgccgacgccggacgc
ttcgtcacgacgatcaagcgccgtctggaagagggcgccttcgaggccgacctggggctc
tag

DBGET integrated database retrieval system