KEGG   Mycobacterium vanbaalenii: Mvan_3924Help
Entry
Mvan_3924         CDS       T00449                                 

Definition
phosphoglycerate mutase
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_3924
   01230 Biosynthesis of amino acids
    Mvan_3924
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_3924
  Energy metabolism
   00680 Methane metabolism
    Mvan_3924
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mvan_3924
Enzymes [BR:mva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Mvan_3924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4194021..4194698)
Genome map
AA seq 225 aa AA seqDB search
MRVRRLVMLRHGQTEYNAGSRMQGQLDTDLSDLGREQAVAAAEVLAKRQPLLIVSSDLRR
ALDTAVALGDRSGQPVSIDTRLRETHLGDWQGMTHLEVDAAAPGARLAWRDDARWAPHGG
ESRVDVADRSLPLVHELVTQQTDWGAAGSDRPVVLVAHGGLIAALTAALLGLPVDNWPVL
GGMGNASWVQLAGHTRADGDPGAFADIRWRLDVWNASAQVANDVL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgcgtcgcctcgtcatgctgcgccacgggcagaccgagtacaacgcgggcagc
cggatgcagggtcagctggacaccgatctgagtgacctgggccgcgaacaggccgtggcc
gccgccgaagtgctcgccaaacgtcaaccgctgctgatcgtctcatcggatctgcgccgg
gcgctggacaccgccgtcgccctcggtgaccgcagcggccaaccggtcagcatcgacacc
cggctacgtgagacacacctcggtgactggcagggcatgacccacctcgaggtcgacgcg
gcggcgccgggcgcccgactggcctggcgcgacgacgcccgctgggccccgcacggcggc
gagagtcgggtcgatgtcgccgatcgcagcctgccactggtgcatgaactggtgacccag
cagaccgattggggcgcagccggttcggatcgcccggtggtgctggtggcccacggcggc
ctgatcgctgcgctgaccgcggcgctgctcggactgccggtcgacaactggccggtgctc
ggcggcatgggcaacgccagctgggtgcagctggccggacacacccgggccgacggtgac
ccgggcgcgttcgccgacatccggtggcgcctcgacgtgtggaacgcctcggcgcaggtt
gccaacgatgtcctctga

DBGET integrated database retrieval system