KEGG   Mycobacterium vanbaalenii: Mvan_3935Help
Entry
Mvan_3935         CDS       T00449                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mvan_3935
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mvan_3935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4205936..4206796
Genome map
AA seq 286 aa AA seqDB search
MATRLSVVGSANVDLTFSVTALPRPGETVLASALSSTPGGKGGNQAVAAARAGAQVQLVA
ALGTDAAAEQLKAHLKANAVGLDGVTAVPGPSGSAAILVDAAGENCIVVAPGANGHLSLS
SPAVREVVADSDVVLLSLEIPIDTAVTAARIGRSAGATVVLNASPASAQASALADLADVV
VVNETESDGWLDGDRPRVPHLVITRGARGATYVGETRLEFPAPAVEAVDTTGAGDVFAGV
LAANWPRGADYALARACAAGALSTLVHGAGDCAPYSEAVEDVLEAS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcggctcagcgtggtgggcagtgccaacgtcgacctcacgttcagcgtgacc
gccctgccacggcccggcgagactgtgctggcctccgccctgtcgtcgacgccgggcggt
aaaggcggaaaccaggcggtcgcggcggcgcgcgccggggcgcaggtccagctcgtcgcg
gcactgggcaccgacgccgccgccgagcaactcaaggcgcatctgaaggccaacgccgtc
ggcctggacggggtcaccgccgtgccgggccccagcggttccgcggcgatcctggtcgac
gccgcgggcgagaactgcatcgtggtcgcgccgggggccaacggccatctgagtctgagc
tcgcctgccgtccgggaggtggtcgccgacagcgacgtggtgctgctgtcgttggagatc
ccgatcgacaccgccgtcacggcggccaggatcgggcgatccgccggtgcgacggtggtg
ctcaacgcctcccccgcgtcggcacaggcgtcggcactggccgacctcgccgacgtggtc
gtcgtcaacgagaccgagtccgacggatggctcgacggggaccggccgcgggtgccgcac
ctggtcatcacccggggcgcccgcggcgccacatacgtcggcgaaacccgtttggagttc
ccggctccggccgtcgaggcggtggacaccacgggcgcgggtgacgtgttcgccggcgtg
ctcgccgcgaactggccccgaggcgccgactacgcgttggccagggcgtgcgccgccggg
gcattgtcgacgctggtgcacggtgcgggtgactgtgccccttacagtgaggcggtcgag
gacgtcctggaagcgtcctga

DBGET integrated database retrieval system