KEGG   Mycobacterium vanbaalenii: Mvan_4105Help
Entry
Mvan_4105         CDS       T00449                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00010  Glycolysis / Gluconeogenesis
mva00030  Pentose phosphate pathway
mva00051  Fructose and mannose metabolism
mva00052  Galactose metabolism
mva00680  Methane metabolism
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01200  Carbon metabolism
mva01230  Biosynthesis of amino acids
Module
mva_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_4105
   00030 Pentose phosphate pathway
    Mvan_4105
   00051 Fructose and mannose metabolism
    Mvan_4105
   00052 Galactose metabolism
    Mvan_4105
  Energy metabolism
   00680 Methane metabolism
    Mvan_4105
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mvan_4105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABM14882
JGI: Mvan4105
UniProt: A1TCI2
Position
4398987..4399985
Genome map
AA seq 332 aa AA seqDB search
MTDITNVRSPVSGSRIVTLTMNPALDIATSTEIVMPTEKMRCSAARYDPGGGGINVARVA
RTLGASVVALFPAGGASGDLFADMLEAIGISAHMIPIAGSTRESITVNELRTQRQYRFVL
PGPTLTAAEQTECLNQLREVAASADFVVASGSLPPGVSPEFYNRIADVCAQLDAPLVLDA
SGGGLQHLTGGNVYLLKPSIRELRECVRRELGSEAEQVAAARELIERGGARNVLVSLGAQ
GALLVTADGAQRYPAVEVPPGSGVGAGDAMVAGVTCGLGRGWGLPKSVRLGIAAGAAMLM
TPGTASCTRADVERLFDRTPDPVDLTVPAADR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcacgaacgtacgctctccggtgagtggttcgcggatcgtcacgttgacc
atgaacccggcgctcgacatcgccaccagcaccgaaatcgtcatgccgacggagaaaatg
cgttgcagcgcagcgcgttacgacccgggcggcggtggcatcaatgtcgccagggtggcc
cggaccctcggcgcctcggtggtggctctgtttcccgcaggcggcgccagtggtgatctg
ttcgccgacatgctggaggctatcggcatctcggcgcacatgatcccgatcgccggctct
acccgggagagcatcacggtcaacgaactccgcacccagcgccagtatcgcttcgtactg
cctgggccgaccctgacggccgccgaacagacggaatgcctgaaccaactccgcgaggtc
gcggcgtcggccgatttcgtggtcgccagcggaagtctcccgcccggcgtctcaccggag
ttctacaaccggatcgccgatgtgtgcgcacagctggacgcccccctggtcctcgacgcc
tccggcggcggtttgcagcacctcacgggcggcaacgtttacctgctcaagcccagtatc
cgggagctccgtgagtgcgtccgccgcgagttgggcagcgaggcggaacaggtggcggcg
gcccgagaactcatcgagcggggaggcgcacgcaacgtcctggtgtcgctgggcgcccag
ggcgccctgctggtcaccgccgacggggcccagcgctacccggcggtcgaggtgcctccc
ggcagcggtgtcggggcgggcgacgccatggtcgccggcgtcacctgtgggctgggccgc
gggtgggggctgcccaagtccgtccgactgggtatcgccgcgggcgctgccatgctcatg
accccgggaacggcgtcgtgcacccgcgccgatgtcgagcgactcttcgaccggactccc
gacccggtcgacctgacggtcccggccgccgaccgctga

DBGET integrated database retrieval system