KEGG   Mycobacterium vanbaalenii: Mvan_4271Help
Entry
Mvan_4271         CDS       T00449                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mva  Mycobacterium vanbaalenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4581277..4582290)
Genome map
AA seq 337 aa AA seqDB search
MAGTKLVIGASGFLGSHVTKQLIAAGEDDVRVLIRTTSSTRGIDGLPVQVHYGDIFDTGA
LRAAMAGCDVVYYCVVDARPWLRDPAPMWRTNVDGLRNVLDVAVGAGLHRFVFTSSIGTI
GLAADGLADEDTAHNWLDKGGAYIRSRVEAEQMVLRYSAEKGLPAVAMCVANTYGPGDFL
PTPHGGMLAAAVAGRLPFYIDGYDAEVVGIEDAARAMILAAERGRTGERYIVSERFMSTR
EIHEIGCAAVGVAPPKFGVPIRVMSAAGYLSEGVARLRGKDTMLTPLNIRLMHIMSPMDH
SKAVRELDWHPQPTSEAIVAAAHFFRDRRQRAAQGAR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaacgaagttggtgatcggtgccagcggcttcctgggatcccacgtcaccaag
cagttgatcgccgcaggcgaggacgacgtccgggtcctgatccgcaccaccagctcgacg
cgcggcatcgacggactgccggtgcaagtccactacggcgacatcttcgacaccggcgcg
ctgcgggccgcgatggccggctgtgacgtcgtctactactgcgtggtcgatgcacgtccg
tggctgcgggatccggcaccgatgtggcggaccaacgtcgacgggctgcgcaatgtcctc
gacgtcgcggtcggcgccggcctgcaccgcttcgtcttcaccagctccatcggcacgatc
gggctggccgcggacggactggccgacgaagacacggcgcacaactggctggacaagggc
ggtgcctatatccggtcccgggtggaggccgaacagatggtgctccggtacagcgcggag
aaggggctgcccgcagtcgcgatgtgcgtggccaacacctacggaccgggcgacttcctg
ccgacgccgcacggcgggatgctcgccgctgcggtggcgggcaggctcccgttctacatc
gacggctacgacgccgaggtggtcggcatcgaggatgcggcgcgcgcgatgatcctcgcc
gcggagcgtggccgcaccggcgagcgttacatcgtcagcgagcggttcatgagcactcgg
gagatacatgaaatcggttgtgccgcagtgggagtcgcgccgccgaagttcggtgtcccg
atccgggtgatgtcggcggccgggtatctgagcgaaggagtggcccggcttcgcggcaag
gacaccatgctcacgccgctcaacatccgcctgatgcacatcatgtcgccgatggaccat
tccaaggctgttcgtgaactcgactggcacccgcaacccacatcggaggcaatcgtggcg
gccgcgcacttcttccgggaccggcgtcagcgtgcggcacagggggcccgatga

DBGET integrated database retrieval system