KEGG   Mycobacterium vanbaalenii: Mvan_4302Help
Entry
Mvan_4302         CDS       T00449                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mvan_4302
Enzymes [BR:mva01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mvan_4302
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mvan_4302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4611193..4613406
Genome map
AA seq 737 aa AA seqDB search
MTNVSNLNNQVDSPHLRPHTADLNRLLAGEHHDPHAILGAHEYDDHTVIRAYRPHAVAVV
AVVGKNRYPLRHIEAGLFAVAVPFTNLIDYRFEIRYSEDESAFVHTVADAYRFLPTLGEV
DLHLFAEGRHERLWEILGAHPRSFTTSDGVVNGVSFAVWAPNAKGVSVTGDFNHWGNEAQ
MRVLGSTGVWELFWPNFPDGGLYKFRVHGADGSVTDRADPMAFATEVPPQTASRVFRSDY
TWSDQEWMSGRALRNPVFEPMSTYEVHLGSWRPGLSYIELAEQLTDYVVEHGFTHVEMLP
VAEHPFGGSWGYQVTSYYAPSSRFGTPDEFRYLVDALHRAGIGVIVDWVPAHFPKDAWAL
GRFDGTALYEHGDPRRGEQLDWGTYVFDFGRSEVRNFLVANALYWLQEYHIDGLRVDAVA
SMLYLDYSRPEGGWSPNIYGGRENLEAVQFLQEMNATVHKINPGIVTIAEESTSWPGVTR
PTNLGGLGFSMKWNMGWMNDTLEFIKRDPIHRSYHHHEMTFSLLYAFSENFVLPISHDEV
VHGKGTLWGRMPGNDHMKAAGIRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEERGVDWFQ
LDEQGFSGGILRMMTDANEIYRSRRALWSRDTQPEGYSWIDANDSANNVLSFLRFGDDGS
MMACVFNFSGSEHTRYRLGLPHAGRWREVLNTDSDTYHGTGIGNYGAVEATDEPWHGRPA
SAVMVLPPLSALWFEPE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtgtccaatctcaacaaccaggtcgacagcccccatctgcgaccacacacc
gccgacctgaaccgcctgctggccggtgagcaccatgatccgcacgcgatcctgggcgct
cacgagtacgacgaccatacggtgatccgcgcctaccggccccatgcggtcgcggtcgtc
gcggtcgtcggcaagaaccgttatccgttgcggcacatcgaggccggtctgttcgcggtc
gcggtgccgttcaccaacctgatcgactaccggttcgagatcagatactccgaggacgag
tcggccttcgtgcacaccgtcgccgacgcctaccggttcctgcccacgctgggcgaggtc
gacctgcacctgttcgccgagggtcgccacgagcgcctctgggagatcctgggcgcgcac
ccgcgcagcttcaccacctcggacggggtggtcaacggggtgtcgttcgccgtgtgggcg
ccgaatgccaagggcgtcagcgtaaccggtgatttcaaccactggggcaacgaggcccag
atgcgggtgctcggttcgaccggggtgtgggagctgttctggccgaacttccccgacggc
gggctctacaagttccgggtgcacggcgccgacggttcggtcaccgaccgggcggatccg
atggccttcgccaccgaagttccgccgcagacggcctcacgggtgttccgcagcgactac
acctggagcgaccaggagtggatgagcgggcgcgcgttgcgcaacccggtgttcgagccg
atgagcacctacgaggtgcacctcggttcatggcgaccgggcctgagctacatcgaactc
gccgagcagctcaccgactacgtcgtcgagcacggcttcacccacgtcgagatgctgccc
gtcgccgagcatccgttcggagggtcgtggggctatcaggtcacgtcctactacgcaccg
tcctcgcggttcgggacgcccgacgagttccggtacctcgtcgacgcactgcaccgggcc
ggcatcggcgtgatcgtggactgggtgcccgcacacttcccgaaggacgcgtgggcgctg
ggccgcttcgacggcaccgcgctctatgaacacggcgatccgcgccgcggcgagcagttg
gactggggcacttacgttttcgacttcggacgatccgaggtccgcaacttcctggtcgcc
aacgcgctgtactggctgcaggagtaccacatcgacgggttgcgggtggacgccgtcgcg
tcgatgctgtacctcgactactctcggcccgagggtggttggtcaccgaacatctacggc
ggccgggagaacctggaggccgtgcagttccttcaggagatgaacgccaccgtccacaag
atcaaccccggcatcgtcaccatcgccgaggagtccacgtcgtggcccggggtcacccgc
cccaccaatctgggcgggctcgggttctcgatgaagtggaacatgggctggatgaacgac
acgttggagttcatcaagcgtgacccgatccaccgcagctaccaccaccacgagatgacc
ttctcgctgctgtacgcgttcagcgagaacttcgtgctgccgatcagccacgacgaggtc
gtgcacggcaagggcacgctgtggggccggatgccgggcaacgaccacatgaaggcggcc
ggtatccgcagcctgctcgcctaccagtgggcccacccgggcaaacagttgctgttcatg
ggacaggagttcggccagcgcgccgaatggtcggaagaacgtggcgtcgactggttccag
ctcgacgagcagggcttctccggcggaatcctgcggatgatgaccgatgccaacgagatc
taccgcagccgccgcgcactgtggtcccgggacacccagcccgagggttactcgtggatc
gacgccaacgattcggccaacaacgtgctgagtttcctgcggttcggcgacgacggctcg
atgatggcgtgtgtcttcaacttctccgggtccgagcacacccggtaccgcctcggactg
ccgcacgccggacgctggcgcgaggtgctcaacaccgactccgacacctatcacggcacg
ggcatcggcaactacggcgccgtcgaagccaccgacgagccctggcacggtaggccggcg
tcggcggtgatggtgctaccgccgctgtcggcgctgtggttcgaacccgagtaa

DBGET integrated database retrieval system