KEGG   Mycobacterium vanbaalenii: Mvan_4347Help
Entry
Mvan_4347         CDS       T00449                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mvan_4347
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mvan_4347
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mvan_4347
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mvan_4347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4661561..4662640)
Genome map
AA seq 359 aa AA seqDB search
MSTARAVHQPWPGLIEAYRDRLPIEDSWTTITLREGGTPLLPAPRLSEYTGCTVHLKVEG
LNPTGSFKDRGMTMAVTEAVSRGQQAVLCASTGNTSASAAAYAARAGITCAVLVPQGKIA
MGKLAQAVMHGAKIIQIDGNFDDCLELARKLTSDFPTVSLVNSVNPFRIEGQKTAAFEIV
DALGDAPDVHSLPVGNAGNITAYWKGYTEYHRDGLAARLPRMLGTQAAGAAPLVLGEPVS
DPETIATAIRIGSPASWSSAVEAQQQSGGRFVAATDEEILAAYHLVARAEGVFVEPASAA
SIAGLLKSIEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPAVIPVPVDPVAVVAKLGLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgctcgtgccgtgcaccagccctggccgggcctgatcgaggcctaccgcgac
cgactgccgatcgaggacagttggacgaccatcaccctgcgtgagggcggcaccccgctg
ctcccggcgccccggttgtccgaatacaccggctgcacagtgcatctgaaggtggagggg
ctcaacccgaccggttcgttcaaggaccgcggtatgacgatggcggtcaccgaggcggtg
tcgcggggacagcaggcggtgctgtgcgcctcgacgggcaacacctcggcctcggcggcc
gcgtatgcggcgcgggccgggatcacctgtgccgtgctggtgccccaaggcaagatcgcc
atgggcaagctggcgcaggccgtcatgcacggtgcgaagatcatccagatcgacggcaac
ttcgacgactgcctcgagctcgcccgcaagctgacgagcgacttcccgacggtgtcgctt
gtcaactcggtcaacccgtttcgtatcgaggggcagaagaccgcggcgttcgagatcgtc
gacgcgctcggtgacgcccccgacgtgcactcgcttccggtcggcaacgcgggcaacatc
acggcctactggaagggttacacggagtaccaccgcgacggcctggccgcccggttgccg
cgcatgctcggcacgcaggccgccggtgccgcaccgttggtgctcggcgagccggtgagc
gaccccgagaccatcgccaccgcgatccgcatcggctcaccggcgtcgtggagttcggcg
gtcgaggcgcaacagcagtcgggtggccgcttcgtggccgccactgacgaggagatcctg
gccgcctaccacctcgtcgcccgcgccgagggcgtgttcgtcgagccggcgtcggcggcc
agtatcgccgggctgttgaagtccatcgaagacggttgggtcgccaagggatcgacggtc
gtctgtaccgtgaccggaaacggcttgaaggaccccgacaccgcgctcaagggcatgccc
gcggtgatcccggttcccgtcgacccggtcgccgtcgtcgccaagctcggcctggtctag

DBGET integrated database retrieval system