KEGG   Mycobacterium vanbaalenii: Mvan_4611Help
Entry
Mvan_4611         CDS       T00449                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_4611
Enzymes [BR:mva01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Mvan_4611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4953448..4953822
Genome map
AA seq 124 aa AA seqDB search
MTRTPDAVVTEFCAKWTTPDPQELATYFTEDGVYHNIPMTPVVGRDAIAAFITEFTSMVD
GIDFRVHRQISSGNLVFNERTDVMRFKDGRELPLPVAGVFEITEGRIAAWRDYFDMATVT
AAWS
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcacccccgacgccgtggtgaccgagttctgcgcgaagtggaccacccccgat
ccgcaggagttggccacatacttcaccgaagatggtgtctaccacaatattccgatgacg
ccggtggtcggccgcgacgccatcgcggccttcatcaccgagttcacgagcatggtcgac
ggcatcgacttccgggtgcaccgccagatcagctcgggcaacctggtgttcaacgagcgc
accgacgtgatgcggttcaaggacggccgggaactgccgttgccggtggccggggtgttc
gagatcaccgagggccggatcgcggcgtggcgtgactacttcgacatggcgacggtgacc
gcagcgtggagctag

DBGET integrated database retrieval system