KEGG   Mycobacterium vanbaalenii: Mvan_4681Help
Entry
Mvan_4681         CDS       T00449                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00071  Fatty acid degradation
mva00280  Valine, leucine and isoleucine degradation
mva00281  Geraniol degradation
mva00310  Lysine degradation
mva00360  Phenylalanine metabolism
mva00362  Benzoate degradation
mva00380  Tryptophan metabolism
mva00410  beta-Alanine metabolism
mva00627  Aminobenzoate degradation
mva00640  Propanoate metabolism
mva00650  Butanoate metabolism
mva00903  Limonene and pinene degradation
mva00930  Caprolactam degradation
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01212  Fatty acid metabolism
Module
mva_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mvan_4681
   00650 Butanoate metabolism
    Mvan_4681
  Lipid metabolism
   00071 Fatty acid degradation
    Mvan_4681
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mvan_4681
   00310 Lysine degradation
    Mvan_4681
   00360 Phenylalanine metabolism
    Mvan_4681
   00380 Tryptophan metabolism
    Mvan_4681
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mvan_4681
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_4681
   00281 Geraniol degradation
    Mvan_4681
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_4681
   00627 Aminobenzoate degradation
    Mvan_4681
   00930 Caprolactam degradation
    Mvan_4681
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mvan_4681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABM15456
JGI: Mvan4681
UniProt: A1TE56
Position
5021991..5022773
Genome map
AA seq 260 aa AA seqDB search
MGSQNFETIIVERDDRVATITLNRPKALNALNSQVMDEVTTAAAELDADAGVGAIILTGS
EKAFAAGADIKEMAGLSFADVFSSDFFAGWGKFAATRTPTIAAVAGYALGGGCELAMMCD
ILIAADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRNMGAEEAERAGLVS
RVVPADTLLEEARSVAKTIAGMSLSASRMAKEAVDRAFETTLTEGLLYERRLFHSAFATD
DQTEGMNAFTEKRSPNFTHR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggctcacagaactttgaaacgatcatcgtcgagcgcgacgaccgcgtcgcgaccatc
acgctgaacaggcccaaggcgctcaacgcgctcaacagccaggtgatggacgaagtcacc
acggccgcagccgaactcgacgccgatgcgggcgtcggcgcgatcatcctcaccggaagc
gagaaggccttcgcggccggcgccgacatcaaggagatggccggcctgtcgttcgccgac
gtgttctcgtccgacttcttcgccggctggggcaaattcgccgcgacacggacaccgacc
atcgccgcggtagccggctacgcactgggcggcggctgcgagctggcgatgatgtgcgac
atcctgatcgccgccgacaccgcgaagttcggccagcccgagatcaaactcggtgtgctg
ccgggcatgggcggatcgcagcggctgacccgggccatcggcaaggccaaggcgatggac
ctgattctgaccggccgcaacatgggcgccgaggaagccgaacgcgccgggctggtgtcg
cgggtggtccccgccgacacgctgctcgaggaggccaggtctgtcgccaagacgatcgcg
ggcatgtcgttgtcggcgtcgcggatggccaaggaggccgtcgaccgcgcattcgaaacc
acgctgaccgaaggcctgctctacgagcgtcgactcttccactcggcgttcgccaccgac
gaccagaccgagggaatgaacgcgttcaccgagaagcggtcacccaacttcacacatcgc
tag

DBGET integrated database retrieval system