KEGG   Mycobacterium vanbaalenii: Mvan_4799Help
Entry
Mvan_4799         CDS       T00449                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mva00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5138411..5139379)
Genome map
AA seq 322 aa AA seqDB search
MSARDGNTASEWVPTGSVTVRVPGKVNLYLDVGDRRDDGYHELTTVFHAVSLLDEVTVRT
ADILSLEMTGEGAESLPTDERNLAWRAAELMADHVGRSPDVAISIEKTIPVAGGMAGGSA
DAAAVLVAMNSLWELGVPRRDLHALAAQLGSDVPFALHGGTALGTGRGEELATVLTRNTF
HWVLAFSPGGLSTAKVFAEIDRLRAEEDRTLPPRLESPEPVLAALASGDPAQLAPLLGND
LQPAALSLDSTLRRTLRAGVDAGALAGVVSGSGPTCAFLCGSAGAAVDVGTELAGAGVCR
TVRVASGPVQGARVVPSPSNAG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcgcgtgacggtaatacggcttccgagtgggttcccacgggttcggtcacggtc
cgtgtgcccggcaaggtcaacctctatctggatgtgggcgatcgtcgggacgacggctat
cacgaattgaccaccgtgttccacgcggtgtcactgctcgacgaggtcaccgtccggacc
gcggacatcctgtcgctggagatgaccggcgagggcgccgagtcgctgccgaccgacgag
cgcaacctggcgtggcgggccgcggaactgatggccgaccacgtcggacggtctcccgat
gtggcgatctcgatcgagaagaccatcccggtggccggcggcatggcgggcggcagcgcc
gacgcggccgctgtgctggtggcgatgaactcgctctgggaactcggcgtgccccggcgt
gacctgcacgccctggccgcccagttgggcagcgatgtcccgttcgcgctgcacggtggc
accgcgttggggacgggccggggcgaggaactggcgacggtgttgacgcgcaacacgttt
cactgggtgctggcgttctcgcccggcgggctgtccaccgcgaaggtgttcgccgagatc
gatcgtctgcgcgccgaggaggaccgcaccctgccgccgcgcctggaatcacccgaaccc
gtgctcgccgccctcgcctcgggggacccggcccaactggcgccgttgctcggcaacgac
ctgcagcccgctgcactgagcctggactccacgctccgccgcacgctgcgcgcgggtgtc
gacgcgggtgcgctggcgggtgtggtgtcgggatcgggcccgacttgcgcgttcctgtgt
ggatcggccggcgccgcggtcgacgtcgggaccgaactggccggcgcgggcgtgtgccgg
acggtgcgcgtggcgagcgggcccgtgcagggcgcgcgggtggtgccgagcccgtcgaac
gccggctga

DBGET integrated database retrieval system