KEGG   Mycobacterium vanbaalenii: Mvan_4825Help
Entry
Mvan_4825         CDS       T00449                                 

Definition
regulatory protein ArsR
Organism
mva  Mycobacterium vanbaalenii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5163594..5163980)
Genome map
AA seq 128 aa AA seqDB search
MSTDWHNRVMPKALPSIDISAPVCCAPVAAGPMSDEDALQVALRLKALADPARVKIMSHL
YSSAAGEENSGSLAKVLGLTESTVSHHLSQLRRAGLVESDRRGMNVYHRPHRDAIGALCV
VLDPNCCA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagactggcataatcgggtcatgccgaaagcgctgcctagcatcgatatctcc
gcgccggtgtgctgtgcacccgttgcggcgggacccatgagcgatgaagacgcgctacaa
gtggcgcttcgcctgaaggcgctcgccgacccggcgcgggtgaagatcatgtcccacctc
tacagctccgcggccggggaggagaacagcggcagcctggcgaaggtcctgggcctgacg
gagtccaccgtcagtcaccatctcagccagcttcggcgggcagggctggtggaatcagac
cgtcgcgggatgaacgtctaccaccggccgcaccgcgacgcgatcggcgcgctgtgcgtg
gtgctggacccgaactgctgcgcctga

DBGET integrated database retrieval system