KEGG   Mycobacterium vanbaalenii: Mvan_4833Help
Entry
Mvan_4833         CDS       T00449                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mvan_4833
   00052 Galactose metabolism
    Mvan_4833
   00500 Starch and sucrose metabolism
    Mvan_4833
   00520 Amino sugar and nucleotide sugar metabolism
    Mvan_4833
Enzymes [BR:mva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mvan_4833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5171525..5172448)
Genome map
AA seq 307 aa AA seqDB search
MNRAEVPIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLII
VTSEGKDGVVAHFVEDLVLEGTLEARGKKTMLEKVRRAPALIKVESVVQAEPLGLGHAIS
CVEASLAPDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVDREDISAYGVID
VEPLPDANNPNVLKVKGMVEKPKPEDAPSLYAAAGRYVLDRAIFDALRRIPRGAGGELQL
TDAIALLIQEGHPVHVVIHRGSRHDLGNPGGYLKAAVDFALERDDYGPELRRWLVERLGL
APATSGQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgggctgaagtacccattccgcggacggcggtcgtcccggcggctgggctggga
acgcgatttcttcccgccacgaagacggtgccgaaggagttgctgccagtcgtcgacaca
cccggcatcgagttggtcgccgccgaggcggccgaggccggcgccgaacgtctgatcatc
gtgacctccgagggcaaggacggcgtcgtcgcccacttcgtcgaggacctggtgctggag
ggcacgctggaggcccgcggcaagaagacgatgctggagaaggtgcggcgggcgcccgcg
ctgatcaaggtcgagtccgtcgtgcaggccgaacctctgggcctgggccacgcgatcagc
tgtgtcgaagccagcctggcgcccgacgaagacgcgatcgcggtgttgttgcccgacgat
ctcgtgctgccgaccggggtattggagacgatgtcgaaggtgcgcgccaagcgcggcggc
tcggtgctgtgcgcgatcgaggtggaccgcgaagacatcagcgcctacggcgtcatcgac
gtggaaccccttcccgacgcgaacaaccccaacgtcctcaaggtcaagggaatggtggaa
aagcccaagcccgaggacgcgccgtcgctgtacgcggcggccggacgctacgtactcgac
cgggcgatcttcgatgcgctgcggcgcatcccgcggggcgcgggcggcgagctgcaactc
accgacgcgatcgcgctgctgatccaggaaggccatccggtgcatgtcgtcatccatcgc
ggatctcgacacgacctgggaaatcccggaggctacctgaaggctgcggttgactttgcg
ttggagcgggacgactacgggcctgaactgcgccggtggttggtcgagcggctgggcctc
gctccggcgacgtccggacagtag

DBGET integrated database retrieval system