KEGG   Mycobacterium vanbaalenii: Mvan_4854Help
Entry
Mvan_4854         CDS       T00449                                 

Definition
(GenBank) putative magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00860  Porphyrin and chlorophyll metabolism
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvan_4854
Enzymes [BR:mva01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mvan_4854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3 MCM AAA_16 AAA_PrkA ABC_tran NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: ABM15627
JGI: Mvan4854
UniProt: A1TEM7
Position
complement(5193798..5195189)
Genome map
AA seq 463 aa AA seqDB search
MTSPNDLPRTVGELRASGHQERSIKAEIRENLLSALASGAGADAVWPGILGFEDTVIPQL
ERALIAGHDVVLLGERGQGKTRLLRALTNLLDEWTPVIAGAELGEHPYSPITPESIRRAA
DSGDDLPITWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRA
HRGIVAVNELPDLAERIQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPPELDAEVGVITQEAHLAAEVPDYLLQILARFARSLRESSSIDQ
RSGVSARFAIAAAETVAASARHRAALLGEQDPVARVVDLQNVIDVLRGKLEFESGEEGRE
QAVLEHLLRRATAETAQRLLGGIDVGPIVTAVENGSPVTTGERVSAREVLAAVPEVSAVA
EIQQRLGATSEGQRAAAMELALEALYLAKRIDKVSDEGETVYG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacctaacgacctgccccgaaccgtcggcgaactgcgtgcctccggccatcag
gagcgcagcatcaaggccgagatccgggagaacctgctgtcggcgctggcgtccggagcc
ggtgccgatgcggtctggccgggcattctcggcttcgaggacaccgtcatcccccagctg
gagcgggcgttgatcgccggacacgacgtcgtcctgctcggtgaacgcgggcagggcaag
acgcggctccttcgtgcgctcaccaacctgctcgacgagtggacgccggtgatcgccggc
gccgagctcggtgagcacccgtacagcccgatcacccccgagtcgatccggcgggcggcc
gactccggtgacgacctgccgatcacctggcggcaccgcagcgagcgctacaccgagaaa
ctggccaccccggacaccagcgtggccgacctggtcggtgacatcgacccgatcaaggtc
gccgagggacgcagcctcggggacccggagaccatcgcctacggcctgatcccgcgggca
caccggggcatcgtcgcggtcaacgagcttcccgacctggctgaacggatccaggtggcg
atgctcaacgtgatggaggagcgcgacatccaggtccgcgggtacacgctgcggctgccg
ctggacgtgctggtcgtcgccagcgccaaccccgaggactacaccaaccgcgggcgcatc
atcaccccgctcaaggaccggttcggcgccgagatccgcacccactacccgcccgagctc
gacgccgaggtcggcgtcatcacccaggaggcgcacctggccgccgaggtgcccgactac
ctgctgcagattctggcccgcttcgcacgcagcctgcgcgaatccagctccatcgaccag
cgctccggggtttcggcccggttcgcgatcgcggccgcagaaaccgtcgccgcgtcggcc
cgccaccgcgcggccctgctcggcgagcaggatccggtcgcgcgggtggtcgacctgcag
aacgtgatcgacgtgctgcggggcaagctcgaattcgagtccggcgaggagggccgcgag
caggccgtcctcgagcatctgctgcgccgcgccacggccgagacggcgcaacggctgctc
ggcggcatcgacgtcggaccgatcgtcaccgccgtggagaacggctcgcccgtcaccacc
ggggaacgggtgtccgcccgcgaggtgctggccgcagttcccgaggtgtccgccgtcgcc
gaaatccagcagcggctcggtgcgacgtccgaagggcagcgcgccgccgcgatggagttg
gcgctggaagccctgtatctggccaagcgcatcgacaaggtgtccgacgaaggcgaaacc
gtctatggctaa

DBGET integrated database retrieval system