KEGG   Mycobacterium vanbaalenii: Mvan_4854Help
Entry
Mvan_4854         CDS       T00449                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvan_4854
Enzymes [BR:mva01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mvan_4854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5193798..5195189)
Genome map
AA seq 463 aa AA seqDB search
MTSPNDLPRTVGELRASGHQERSIKAEIRENLLSALASGAGADAVWPGILGFEDTVIPQL
ERALIAGHDVVLLGERGQGKTRLLRALTNLLDEWTPVIAGAELGEHPYSPITPESIRRAA
DSGDDLPITWRHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRA
HRGIVAVNELPDLAERIQVAMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPPELDAEVGVITQEAHLAAEVPDYLLQILARFARSLRESSSIDQ
RSGVSARFAIAAAETVAASARHRAALLGEQDPVARVVDLQNVIDVLRGKLEFESGEEGRE
QAVLEHLLRRATAETAQRLLGGIDVGPIVTAVENGSPVTTGERVSAREVLAAVPEVSAVA
EIQQRLGATSEGQRAAAMELALEALYLAKRIDKVSDEGETVYG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacctaacgacctgccccgaaccgtcggcgaactgcgtgcctccggccatcag
gagcgcagcatcaaggccgagatccgggagaacctgctgtcggcgctggcgtccggagcc
ggtgccgatgcggtctggccgggcattctcggcttcgaggacaccgtcatcccccagctg
gagcgggcgttgatcgccggacacgacgtcgtcctgctcggtgaacgcgggcagggcaag
acgcggctccttcgtgcgctcaccaacctgctcgacgagtggacgccggtgatcgccggc
gccgagctcggtgagcacccgtacagcccgatcacccccgagtcgatccggcgggcggcc
gactccggtgacgacctgccgatcacctggcggcaccgcagcgagcgctacaccgagaaa
ctggccaccccggacaccagcgtggccgacctggtcggtgacatcgacccgatcaaggtc
gccgagggacgcagcctcggggacccggagaccatcgcctacggcctgatcccgcgggca
caccggggcatcgtcgcggtcaacgagcttcccgacctggctgaacggatccaggtggcg
atgctcaacgtgatggaggagcgcgacatccaggtccgcgggtacacgctgcggctgccg
ctggacgtgctggtcgtcgccagcgccaaccccgaggactacaccaaccgcgggcgcatc
atcaccccgctcaaggaccggttcggcgccgagatccgcacccactacccgcccgagctc
gacgccgaggtcggcgtcatcacccaggaggcgcacctggccgccgaggtgcccgactac
ctgctgcagattctggcccgcttcgcacgcagcctgcgcgaatccagctccatcgaccag
cgctccggggtttcggcccggttcgcgatcgcggccgcagaaaccgtcgccgcgtcggcc
cgccaccgcgcggccctgctcggcgagcaggatccggtcgcgcgggtggtcgacctgcag
aacgtgatcgacgtgctgcggggcaagctcgaattcgagtccggcgaggagggccgcgag
caggccgtcctcgagcatctgctgcgccgcgccacggccgagacggcgcaacggctgctc
ggcggcatcgacgtcggaccgatcgtcaccgccgtggagaacggctcgcccgtcaccacc
ggggaacgggtgtccgcccgcgaggtgctggccgcagttcccgaggtgtccgccgtcgcc
gaaatccagcagcggctcggtgcgacgtccgaagggcagcgcgccgccgcgatggagttg
gcgctggaagccctgtatctggccaagcgcatcgacaaggtgtccgacgaaggcgaaacc
gtctatggctaa

DBGET integrated database retrieval system