KEGG   Mycobacterium vanbaalenii: Mvan_4870Help
Entry
Mvan_4870         CDS       T00449                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00020  Citrate cycle (TCA cycle)
mva00640  Propanoate metabolism
mva00660  C5-Branched dibasic acid metabolism
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01200  Carbon metabolism
Module
mva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mvan_4870
   00640 Propanoate metabolism
    Mvan_4870
   00660 C5-Branched dibasic acid metabolism
    Mvan_4870
Enzymes [BR:mva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mvan_4870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABM15643
JGI: Mvan4870
UniProt: A1TEP3
Position
complement(5213976..5215139)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTESAEDAKAIAEEIGKPVMVKAQVKVGGRGKAGGVK
YAATPEDALTHAQNILGLDIKGHIVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDEAFAREIAEKGHLPAEVLDAAAVTIAKLWEVF
VKEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHAEFEDKDATDPLELKAKEN
DLNYVKLDGAVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDGNNVEEGRRIL
SEANHPLVIQADTMDSGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggacctcttcgagtatcaggcgaaagagctgttcgccaagcacaacgttcccaccacc
cccggccgggtgaccgaatccgccgaggatgccaaagcgatcgccgaggaaatcggcaag
cctgtcatggtcaaggcgcaggtcaaggtcggcggccgcggcaaggccggcggcgtcaag
tacgcggccacccccgaggacgcgctgacccacgcgcagaacatcctgggcctggacatc
aagggccacatcgtcaagaagctgctggtcgccgaggccagtgacatcgccgaggagtac
tacatctccttcctgctcgaccgcgccaatcgcacctacctggcgatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgccgccaccaagcccgagcggctggccaaggtgccc
gtcgacgcggtcaagggtgtcgacgaggcgttcgcacgcgagatcgccgagaagggccac
ctgcccgccgaggtgctcgacgccgccgcggtgacgatcgccaagctgtgggaggtcttc
gtcaaggaggacgccacgctggtcgaggtgaaccccctggtgcgtacgcccgacgatcag
atcctggcgctggacggcaaggtcaccctcgacgccaacgcagacttccggcagcccggc
cacgccgagttcgaggacaaggacgccacggatcccctcgagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggtgccgtcggcatcatcggcaacggcgccggcctg
gtcatgtcgacgctggacgtggtcgcctacgccggcgagaagcacggcggcgtgaagccg
gccaacttcctcgacatcggtggcggcgcgtcggccgaggtgatggccgcgggcctggac
gtcatcctcaatgacagccaggtcaagagcgtgttcgtcaacgtgttcggcggcatcacc
gcgtgcgacgcggtggccaacggcatcgtcaaggccctggagatcctcggcgacgaggcc
aacaagccgctcgtggtgcgtctcgacggcaacaacgtcgaagagggtcgccgcatcctg
tccgaggccaaccatccgctggtcatccaggccgacaccatggactccggcgccgacaag
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system