KEGG   Mycobacterium vanbaalenii: Mvan_4870Help
Entry
Mvan_4870         CDS       T00449                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvan_4870
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mvan_4870
   00640 Propanoate metabolism
    Mvan_4870
   00660 C5-Branched dibasic acid metabolism
    Mvan_4870
Enzymes [BR:mva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mvan_4870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5213976..5215139)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTESAEDAKAIAEEIGKPVMVKAQVKVGGRGKAGGVK
YAATPEDALTHAQNILGLDIKGHIVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDEAFAREIAEKGHLPAEVLDAAAVTIAKLWEVF
VKEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHAEFEDKDATDPLELKAKEN
DLNYVKLDGAVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDGNNVEEGRRIL
SEANHPLVIQADTMDSGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggacctcttcgagtatcaggcgaaagagctgttcgccaagcacaacgttcccaccacc
cccggccgggtgaccgaatccgccgaggatgccaaagcgatcgccgaggaaatcggcaag
cctgtcatggtcaaggcgcaggtcaaggtcggcggccgcggcaaggccggcggcgtcaag
tacgcggccacccccgaggacgcgctgacccacgcgcagaacatcctgggcctggacatc
aagggccacatcgtcaagaagctgctggtcgccgaggccagtgacatcgccgaggagtac
tacatctccttcctgctcgaccgcgccaatcgcacctacctggcgatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgccgccaccaagcccgagcggctggccaaggtgccc
gtcgacgcggtcaagggtgtcgacgaggcgttcgcacgcgagatcgccgagaagggccac
ctgcccgccgaggtgctcgacgccgccgcggtgacgatcgccaagctgtgggaggtcttc
gtcaaggaggacgccacgctggtcgaggtgaaccccctggtgcgtacgcccgacgatcag
atcctggcgctggacggcaaggtcaccctcgacgccaacgcagacttccggcagcccggc
cacgccgagttcgaggacaaggacgccacggatcccctcgagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggtgccgtcggcatcatcggcaacggcgccggcctg
gtcatgtcgacgctggacgtggtcgcctacgccggcgagaagcacggcggcgtgaagccg
gccaacttcctcgacatcggtggcggcgcgtcggccgaggtgatggccgcgggcctggac
gtcatcctcaatgacagccaggtcaagagcgtgttcgtcaacgtgttcggcggcatcacc
gcgtgcgacgcggtggccaacggcatcgtcaaggccctggagatcctcggcgacgaggcc
aacaagccgctcgtggtgcgtctcgacggcaacaacgtcgaagagggtcgccgcatcctg
tccgaggccaaccatccgctggtcatccaggccgacaccatggactccggcgccgacaag
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system