KEGG   Mycobacterium vanbaalenii: Mvan_5066Help
Entry
Mvan_5066         CDS       T00449                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00071  Fatty acid degradation
mva00280  Valine, leucine and isoleucine degradation
mva00281  Geraniol degradation
mva00310  Lysine degradation
mva00362  Benzoate degradation
mva00380  Tryptophan metabolism
mva00410  beta-Alanine metabolism
mva00640  Propanoate metabolism
mva00650  Butanoate metabolism
mva00903  Limonene and pinene degradation
mva00930  Caprolactam degradation
mva01040  Biosynthesis of unsaturated fatty acids
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01200  Carbon metabolism
mva01212  Fatty acid metabolism
Module
mva_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mvan_5066
   00650 Butanoate metabolism
    Mvan_5066
  Lipid metabolism
   00071 Fatty acid degradation
    Mvan_5066
   01040 Biosynthesis of unsaturated fatty acids
    Mvan_5066
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mvan_5066
   00310 Lysine degradation
    Mvan_5066
   00380 Tryptophan metabolism
    Mvan_5066
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mvan_5066
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_5066
   00281 Geraniol degradation
    Mvan_5066
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_5066
   00930 Caprolactam degradation
    Mvan_5066
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mvan_5066
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mvan_5066
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mvan_5066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABM15837
JGI: Mvan5066
UniProt: A1TF87
Position
complement(5433513..5435672)
Genome map
AA seq 719 aa AA seqDB search
MAENTIQWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVEKLVAEKESITGVVIASA
KKTFFAGGDLKGMMNVGPDNAAESFAEVEFIKADLRKLETLGKPVVAAINGAALGGGLEI
ALACHHRIAADTKGVVIGLPEVTLGLLPGGGGVARTVRMFGIQKAFMEILSQGTRFKPGK
ALEIGLVDRLVQSVDELIPAAKAWIKANPEAHTQPWDQKGYKMPGGTPSSPGLASILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTATRIESRYFVTLVTGQTAKNMIQAFFL
DLQAINGGASRPDGIAKQEIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVTLEAAQKGK
AYSEKIEAKALERGRTTKEKSDALLARITPTADAADLKGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVPAASIEQAGSQAGYP
AAPLQLSDELNLELMQKIANETRKATEAAGGTYEPHPAELVVNKMIEIGRPSRLKGAGFY
SYIDGKRVGLWEGLAETFGAGSGHGPATMPLQDMIDRMLFAEALETQKCLDEGVLTSTAD
ANIGSIMGIGYPPYTGGSAQFIVGYQGELGVGKDAFVARAKELAAKYGERFNPPASLTS
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacactattcagtgggacaaggatgccgacggcatcgtcaccctgacgctg
gacgacccgaccggttcggccaacgtgatgaacgagcactacaaggaatccatgcacaac
gccgtggaaaaacttgtagcagagaaggagtcgatcaccggtgtggtgatcgccagcgcc
aagaagacgttcttcgccggcggtgacctcaagggcatgatgaacgtcggaccggacaac
gccgccgagtcgttcgccgaggtggagttcatcaaggccgacctgcgcaagctggagacc
ctgggcaagccggtggtggccgcgatcaacggtgcggcgctcggcggcggcctggagatc
gcgctggcctgtcatcaccgcatcgccgccgacaccaagggtgtggtcatcggcctgccc
gaggtcaccctgggcctgctgcccggtggtggcggcgtcgcccgcaccgtccgcatgttc
ggcattcagaaggccttcatggagatcctgagccagggcacccgcttcaagccgggcaag
gccttggaaattgggcttgtggatcggctcgtccagtccgtggatgagctcatccctgct
gccaaggcatggatcaaggccaatcccgaggcgcacacccagccgtgggaccagaagggc
tacaagatgcccggcggcaccccgagcagccctggcctggcgtcgatcctgccgtcgttc
ccggcgctgctgaagaagcagctcaagggtgcgccgatgccggcgccgcgcgccatcctc
gacgccgccgtcgaaggcgcgcaggtcgacttcgacaccgccacccgcatcgagagccgg
tacttcgtcactctggtcaccggccagaccgccaagaacatgatccaggcgttcttcctc
gacctgcaggccatcaacggcggcgcgtcgcggccggacggtatcgccaagcaggagatc
aagaagatcggtgtgctgggcgcgggcatgatgggcgccggcatcgcctacgtctcggcc
aaggccggctacgacgtggtcctcaaggacgtcacgctcgaagccgcccagaagggcaag
gcgtactcggagaagatcgaggccaaggcgctcgagcggggtcgcaccacgaaagagaag
tccgacgcgctgctggcccggatcactccgaccgccgatgccgcggacctcaagggtgtc
gacttcgtgatcgaggccgtcttcgagaaccaggaactcaagcacaaggtgttccaggag
atcgaggacatcgtcgagccgaatgcgttgctggggtcgaacacctccacgctgccgatc
accggtctggcgaccggggtgaagcgccaggaggacttcatcggcatccacttcttcagc
cccgtcgacaagatgccgctggtggagatcatcaagggcgagaagacttctgacgaggcg
ctggcccgggtgttcgactacaccctggccatcggcaagaccccgatcgtggtcaacgac
agccgcggcttcttcacctctcgtgtcatcggcaccttcgtcaacgaggcgctggcgatg
ctgggcgagggtgtgcccgcggccagcatcgaacaggccggttcgcaggccggctacccg
gcggctccgctgcagctctcggacgaactcaacctggagctcatgcagaagatcgccaac
gagacccgcaaggcgaccgaggctgccggcggtacctacgaaccgcacccggccgagttg
gtagtcaacaagatgatcgagatcggtcgtccttcgcggctcaagggtgccggcttctac
tcctacatcgacggcaagcgcgtcggcctgtgggagggcctggccgagacgttcggtgct
ggttccgggcacggcccggcgactatgccgctgcaggacatgatcgaccggatgctgttc
gccgaggcactggaaacgcagaagtgcctcgacgagggcgtgctcacctcgaccgccgat
gccaacatcggctcgatcatggggatcggctacccgccgtacaccggtgggtcggcgcag
ttcatcgtcggttaccagggtgaactgggcgtaggcaaggacgccttcgtggcccgcgcc
aaggagctggccgccaagtacggcgagcggttcaacccgccggcgtcgctgacctcctga

DBGET integrated database retrieval system