KEGG   Mycobacterium vanbaalenii: Mvan_5134Help
Entry
Mvan_5134         CDS       T00449                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mvan_5134
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mvan_5134
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mvan_5134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5496075..5496572)
Genome map
AA seq 165 aa AA seqDB search
MTDTPLTEIALTTLDGRTTTLAELADGAALVVNVASKCGLTPQYGALEQLAKDYGPRGLT
VIGVPCNQFMGQEPGTAEEIQTFCSTNYGVTFPLLEKAEVNGPNRHPLYAELTQTADDAG
EAGDVQWNFEKFLLAPGGKVVKRIRPRTAPDDPEVIAAIEAVVPR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgccgctcaccgaaatcgccttgacgacgctcgacggccgcaccaccact
ttggcggagttggccgacggcgcggcgttggtggtgaacgtcgcctccaaatgtggcctg
accccgcagtacggcgcgctcgagcagctcgcgaaggactacggtccgcgcggcctgacg
gtgatcggtgtgccctgcaaccagttcatggggcaggagccgggcaccgccgaggagatc
cagacgttctgctccaccaactacggtgtgacgttcccgttgctggagaaggccgaggtg
aacgggcccaacaggcacccgctctacgccgagctgacccagaccgccgacgacgccggt
gaggccggggatgtgcagtggaatttcgagaagttcctgctcgcccccggcggcaaggtc
gtcaaacggatccggccccgcaccgcgcccgacgatcccgaggtgatcgcggccatcgaa
gccgtcgtgccgcgatag

DBGET integrated database retrieval system