KEGG   Mycobacterium vanbaalenii: Mvan_5368Help
Entry
Mvan_5368         CDS       T00449                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mva00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5744022..5744549)
Genome map
AA seq 175 aa AA seqDB search
MTSVVLSIGSNLGDRMAHLQSVLDGLAGSALAVSPVYETDAWGGVEQGPFLNAVVLAEDR
ELDGYGWLRRAHELEDAAGRVRDQRWGPRTLDVDLVQCHGPDGEVVVHDDVLTLPHPYAH
ARAFVLVPWLQVEPTATLTVDGRTDPLTAHLAAVDAAERAGVRTTDFVLRIADGA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagtgtggtgttgtccatcgggtccaacctgggtgaccggatggcccacctgcag
tcggtgctcgacggtctcgcaggctccgcgctggcggtgtcgccggtgtacgaaaccgac
gcctggggcggcgtcgagcaggggcctttcctcaatgccgttgtgctggccgaggaccgg
gaactggacgggtacggctggctgcgccgcgcccacgaactggaggatgcggccgggcgg
gtccgggatcagcggtggggccccagaacgctcgatgtcgacctggtgcagtgtcacggt
cccgacggggaggtggtggtccacgacgacgtcctgaccctgccgcacccgtatgcgcac
gcgcgcgctttcgtgttggttccgtggctgcaggtggagccgacggcgacgctgaccgtc
gacggtcgaaccgatccgctcactgcccacctggcggccgtggacgcagcggagcgcgcc
ggtgtgcgcacgaccgacttcgtgttgcggatcgcggacggggcctga

DBGET integrated database retrieval system