KEGG   Mycobacterium vanbaalenii: Mvan_5370Help
Entry
Mvan_5370         CDS       T00449                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mva  Mycobacterium vanbaalenii
Pathway
mva00790  Folate biosynthesis
mva01100  Metabolic pathways
Module
mva_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mvan_5370
Enzymes [BR:mva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mvan_5370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABM16141
JGI: Mvan5370
UniProt: A1TG41
Position
complement(5744913..5745719)
Genome map
AA seq 268 aa AA seqDB search
MGVVNVTDDSFSDGGLFLDRDRAVIHGVELVRQGAAIVDVGGESTRPGATRIDPAVESSR
ILPVVKELAQLGITVSIDTMHAAVARVALEHGAQIVNDVSGGRADPDMARVVADAGVPWV
LMHWRSVGSDRPHEVPPYGDVVTAVRDELMAGVDAAVDAGVDPAKLIIDPGLGFAKTAQH
NWALLHALPEFVTTGIPVLVGASRKRFLGELLASPDGELRPPAGRETATAVVSALAGWHH
VWGVRVHDVRASVDALAVVAAWQAGRDD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcgtcaacgtcaccgatgactcattctccgacggcggcctgttcctcgaccgg
gaccgggcggtcatccacggtgtcgagttggtgcgccagggtgcggcgatcgtcgatgtc
ggcggtgagtcgacacggccgggcgcgacgcgaatcgaccccgccgtggagtcgtcccga
attctgccggtcgtcaaagagcttgcacagcttggcattacggtcagcatcgacacgatg
cacgctgcggtggcgcgggtggcgctggagcacggagcgcagatcgtcaacgacgtgtcc
ggcggcagggcggacccggacatggcgcgggtggtcgcggacgcgggggtgccgtgggtg
ctgatgcactggcgctccgtcggcagtgaccgcccgcacgaggtgccgccctacggcgac
gtggtcaccgcggtgagggacgaactgatggccggcgtcgacgccgccgtcgacgcggga
gtggatcccgccaaactgatcatcgatcccggcctcggattcgccaagaccgcccaacac
aactgggcgttgctccacgcgctgccggagttcgtcacgaccggcatccccgtactggtc
ggcgcctcacgcaagcgcttcctcggggagcttctcgcctcgcccgacggtgagctccgc
ccacccgccggccgggagaccgccaccgcggttgtgtcggcactcgccggctggcatcac
gtctggggagtccgcgtgcacgacgtccgcgcctcggtcgacgcgctggcggtggtggcg
gcctggcaggcaggtcgcgatgactga

DBGET integrated database retrieval system