KEGG   Mycobacterium vanbaalenii: Mvan_5450Help
Entry
Mvan_5450         CDS       T00449                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mvan_5450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_5450
  Lipid metabolism
   00071 Fatty acid degradation
    Mvan_5450
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mvan_5450
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mvan_5450
   00626 Naphthalene degradation
    Mvan_5450
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mvan_5450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5831852..5832922
Genome map
AA seq 356 aa AA seqDB search
MKMRAARMYGYKQPLRLEEVDVPSPGPEEVLVRVGGAGMCRTDFQLIDGYFDNGLSMDFP
ITPGHEVAGWVDGVGSAVPKSAGLAEGDQVVVFGSWGDGACRQCHEGNEQLCAHGVWAGF
GRHGGYQEYLPVNYRYLIKIPGGGELSPDNLAPLTDAGLTPYRGLKKLRNAGHLGPGRTV
AVSGIGGLGSYATQYAKLLGGGAEVVAFARSDEKLKIAKDNGADHVVNVRDKDTEDVRAE
LESATGRTELDAVIECAGSEDSIRLAFSLLAAEGAVASVGLIGNRVDIPLFPLVAREYTF
YGSFWGNYNDLTEVLALARTGQLKHSVTRVRFDDVNETLEAIARGDVLGRAVIVYD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcgggccgcccgcatgtacgggtacaagcagccactgcgcctcgaagaggtc
gatgtgccgtctcccggtcccgaggaggtgctcgtccgggtgggcggtgcgggcatgtgc
cgcactgacttccagctgatcgacggctatttcgacaacggtctttcgatggactttccc
atcacgcccggacacgaggtcgccggctgggtcgacggagtcggatcggcggttccgaag
tcggcggggctggcggagggcgatcaggtggtggtgttcggcagctggggcgatggggcg
tgcaggcaatgtcacgaaggcaacgagcagctgtgcgcgcacggcgtctgggcgggcttc
ggccgccacggcggctatcaggagtacctgcccgtcaactaccggtacctgatcaagatc
cccggcgggggtgaactgtcgccggacaacctggcgccgctgacagacgccgggctgacg
ccctaccgggggttgaagaagttgcgcaacgcggggcacctcgggcccggcaggaccgtc
gcggtgtcgggaatcggcggcctggggagttacgccacgcagtacgcgaaactccttggc
ggcggcgcggaggtggtcgcgttcgcgcgcagcgacgagaagctcaagatcgccaaggac
aacggcgccgaccatgtcgtcaacgtgcgggacaaggacaccgaagacgtccgcgccgaa
ctcgaatcggccactgggcgaacagaactcgatgcggtcatcgagtgcgccggatcggag
gactcgatccggctggcgttctcgctgctggcagccgagggcgcggtggcgtccgtcggc
ctcatcggcaaccgcgtcgacatcccgctcttcccgttggtggcgcgggagtacaccttt
tacgggtcgttctggggcaactacaacgacctcaccgaggtgctggcgctggcgcggacg
ggacagctcaagcactcggtcacccgggtgcgcttcgacgacgtcaacgagaccctcgag
gcgatcgcccgtggcgacgtgctcgggcgcgcagtgatcgtctacgactga

DBGET integrated database retrieval system