KEGG   Mycobacterium vanbaalenii: Mvan_5728Help
Entry
Mvan_5728         CDS       T00449                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mvan_5728
Enzymes [BR:mva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mvan_5728
    3.5.1.-  
     Mvan_5728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6117451..6118011
Genome map
AA seq 186 aa AA seqDB search
MTSNRTLIIVDVQNDFCEGGSLAVAGGAAVARGISDLLASAPDYRHVVATKDFHIDPGPH
FSDHPDYVDSWPVHCVAHTAGAEFHPDLDTTAVEAVFKKGHHSAAYSGFEGKDDNGSALA
DWLRAHDVDAVDVVGIATDYCVKATAADAAAAGFTTRVLSPLTAGVAPATTADALDTLRA
AGVEVL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcgaaccggaccctcatcatcgtggacgtgcagaacgacttctgtgagggcggc
tcgctggcggtcgccggcggcgccgccgtggcgcgcggcatctccgatctgctcgcctcc
gccccggattatcggcatgtggtggcgaccaaggacttccacatcgatccgggaccgcac
ttctcggaccaccccgactacgtcgactcctggccggtgcactgcgtcgcgcacaccgcg
ggcgccgagttccatcccgacctcgacaccacggccgtcgaggcggtgttcaagaagggg
caccactcggccgcctacagcggattcgagggcaaggacgacaacggcagcgcgctcgcg
gactggttgcgggcccacgacgtggacgcggtcgacgtggtgggcatcgccaccgactac
tgcgtgaaggccaccgccgccgacgcggccgcagccgggttcaccacccgggtgctgtca
cctctgaccgccggggtggccccggcgaccaccgccgatgccctggacaccctgcgcgcg
gccggtgtcgaggtcctgtga

DBGET integrated database retrieval system