KEGG   Mannheimia varigena USDA-ARS-USMARC-1388: X875_1520Help
Entry
X875_1520         CDS       T03029                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mve  Mannheimia varigena USDA-ARS-USMARC-1388
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    X875_1520
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    X875_1520
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    X875_1520
Enzymes [BR:mve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     X875_1520
Exosome [BR:mve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X875_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
151765..153234
Genome map
AA seq 489 aa AA seqDB search
MKKLTQLTFSAIAVFYFMVSANAQQAVENTQNSVKAKNVILLISDGAGMQTWNAASYYRH
GTLGKEVYDKFEVKLFASTHSLNTSKQATKSAEGTIKFDSAKLWGNQTSSNIFKGGLGNY
DGYFDGYDYARTDATDSAAAATALATGYKTYNNAINWSNDDTRLKHIGEYVVESGRSLGV
VSSVQWSHATPAGFLAHNPSRNNYAEIGKEIVDSGLATVVMGAGHPYFDENGKSIEPKDE
KAFRFVGGKDTWEKLTSGQTDYHFIEKKDDFIALAEKRLDLGSKSKVLGTTQTASTTQFS
RKGQTSGNLLDNQPDLPTMTKGALNLVSQNPNGFFLMVEGGAVDWAAHANNLPRIIEEQI
DFNLAVEAAVDWVEKNSSWEETLVIVTTDHGNGLLAGPDSDVNPYSPIINQGAGALPLVR
WHTDNHTRELVPVYANGVGADFFHSVARKEPNLGRVYKAEENSRKYIDNTQIFDAATNAL
GIETSKSKQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaactcaattgactttttccgctattgctgtgttctactttatggtatct
gccaatgcacaacaagcggtcgaaaatacgcaaaattctgtaaaagcgaaaaatgtaatt
ttgttaattagtgatggtgcaggaatgcaaacgtggaatgctgccagttattatcgacac
ggcacattaggcaaggaagtctatgataaatttgaagtaaaattattcgcttcaacccac
tcactaaatacctcaaagcaagctacaaaatccgctgagggcacaataaaatttgattcg
gcaaaattatggggaaaccaaacatcaagcaatatatttaaaggcggtcttggcaattat
gatggctattttgatggttatgattatgccagaaccgatgcaaccgacagtgccgctgcg
gcaaccgcactcgctacgggctataaaacctacaataatgcgattaactggtcgaatgat
gatactcgattaaaacatattggcgaatatgtggtagaaagtggtcgctcactaggtgtt
gttagttcggtacaatggagccacgcaacacctgcgggtttcttagctcataacccaagt
cgtaataattacgcagaaattggtaaggaaattgttgattcaggcttagcgacagtcgta
atgggagcagggcacccttattttgatgaaaatggaaaatctattgagcctaaagacgag
aaagcattccgctttgttggcggtaaagatacttgggaaaaattaacttcagggcagaca
gactatcactttattgaaaagaaagatgatttcattgctcttgccgaaaaacgccttgat
ttaggctcaaaatccaaagtattaggcacaactcaaacggcttccactacgcaatttagc
cgtaaaggtcaaacaagcggaaacttgcttgataaccaaccagacttacccacaatgacg
aagggtgcattgaacttagtgagtcaaaatccaaatggctttttcttaatggtagaaggt
ggagcagtggactgggcagctcacgccaataatctaccccgtattattgaagaacagatt
gactttaaccttgccgttgaagcagcggttgattgggttgagaaaaacagttcttgggaa
gaaacccttgtaatagtaactaccgatcacggcaacggcttactggcagggcccgattct
gatgttaatccatactcgccaattatcaatcaaggagctggagcgttaccattagttcgc
tggcatacggacaaccacactcgtgagcttgtgccagtttatgccaacggtgtgggggct
gattttttccacagcgttgctcgcaaagagccgaatttaggacgagtgtataaggctgag
gaaaatagccgtaaatatatcgacaatacgcagatctttgatgccgctacaaatgcacta
ggcattgaaacgagtaaatcaaagcagtaa

DBGET integrated database retrieval system