KEGG   Mannheimia varigena USDA-ARS-USMARC-1388: X875_17240Help
Entry
X875_17240        CDS       T03029                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mve  Mannheimia varigena USDA-ARS-USMARC-1388
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mve00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    X875_17240
Enzymes [BR:mve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     X875_17240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1821637..1822554)
Genome map
AA seq 305 aa AA seqDB search
MKKLTVLGSINADHVISVPYFAKPGETLTGHSYHIAYGGKGANQAVAAARLGAKVSFIGC
IGNDDIGRAMKTAFVQDGIDVGAIKTIDNQMTGIAMIQVAESGENSIVISAGANGHLDES
VVAETQSAISEADCLLMQLETPLPAIIQAAQIAKQHGTKVVLNPAPARALPDELLGLLDM
ITPNETEAEILTGVKVVDEATASQAAEVFHQKGIETVLITLGSKGVFVSENSLGNIVAGF
RVQAVDTTAAGDTFNGALVTAMLEDKPFAEAIRFAHAAAAISVTRKGAQPSIPSRQETLD
FLSKQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcaccgttctcggtagcattaacgctgatcacgtgatttccgttccctac
tttgccaaaccgggggaaacgctcacagggcatagttaccacatcgcttacggcggcaaa
ggggcgaatcaagcggtagcggcggctcgccttggggcgaaggtatcgtttatcggctgt
atcggcaatgatgacattgggcgtgcgatgaagacggcgtttgttcaagacggcattgat
gtcggggcaatcaaaaccatcgacaaccaaatgaccggcattgcgatgatccaagtggcg
gaatcaggcgagaacagtatcgtgatttcagctggagcaaacggacatttagacgaatca
gtcgtggctgaaacccaatctgcgatttccgaagctgattgcttgctaatgcagctagaa
acgccattgcctgcgattatccaagcggctcaaatcgctaaacagcacggcacaaaagtg
gtgttaaacccagcaccagcaagagcgttaccggacgagcttttaggcttgttggatatg
atcaccccgaatgaaaccgaagcggaaattctcaccggcgtgaaagtggttgatgaagcc
accgccagccaagcggcagaggtattccatcaaaaagggattgaaaccgtgttgattaca
cttggctcaaaaggcgtgtttgtgagtgaaaatagcttgggcaacatcgtggcaggcttt
agagtgcaagcggtggataccacggcagccggtgatactttcaacggggcattagttacc
gcaatgttggaagataaaccgttcgccgaggcaattcgttttgcccacgccgcagcagcc
atcagcgtaacccgaaaaggggcgcagccttcgattccaagccgtcaagaaaccttagat
tttttgagtaagcagtaa

DBGET integrated database retrieval system