KEGG   Mannheimia varigena USDA-ARS-USMARC-1312: X874_14260Help
Entry
X874_14260        CDS       T03028                                 

Definition
DeoK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mvg  Mannheimia varigena USDA-ARS-USMARC-1312
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mvg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    X874_14260
Enzymes [BR:mvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     X874_14260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1543960..1544880
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLISYIEDMPKMGETLEAPDFKIGCGGKGANQAIAAAKLGASVMMITKV
GDDMFAENTIKNFQQYGVNTDFVEKVEGVSSGVAPIFVDQSSQNRILIIKGANACLKPED
IDRAEKQLKVCKLIILQLEIPLETVYYAIDFANKYNIPVILNPAPASKSLDIHYACKCNF
FMPNETELEILTGMPVKTMEQIQEAANCLFAKGLKNLIVTLGEKGSVWFHQDKVTHIPPH
KVNAIDTSGAGDAFIGCFAHFYIQTQNVQQAMQMASAYSAYSVTGQGTQTSYPDKVQFEQ
FLQSLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagtaattggctctaatatggtggatttaattagctatattgaagatatg
ccaaaaatgggagaaacacttgaagccccagactttaaaataggctgtgggggtaaaggg
gctaatcaagctattgcagctgctaaattaggtgcttcagttatgatgatcactaaagtt
ggtgatgacatgtttgctgaaaatacgattaagaatttccaacaatatggtgttaatacc
gattttgttgaaaaagtagagggagtttctagtggtgtagcccctatctttgtagatcaa
tcgtcgcaaaatcgaatcctaattatcaaaggtgcaaatgcttgtttgaaaccggaagat
attgaccgtgcagaaaagcaattaaaagtctgtaagcttattattctacaactcgaaatt
cctttagaaactgtctattacgcaattgattttgccaataaatataacattcctgtaatt
cttaaccctgcaccggcaagtaaatcattagatattcactatgcttgtaaatgtaatttc
tttatgccaaatgaaactgaactagagattctaacaggcatgcctgtaaaaactatggag
caaattcaagaagctgcaaattgtttatttgcaaaaggtttaaaaaatctcattgtaact
ttaggtgaaaaaggttctgtatggttccatcaagataaagtaactcacattcctcctcat
aaggtcaatgctattgatactagcggtgcaggcgatgcctttataggttgtttcgctcat
ttttatattcaaactcaaaatgtacaacaagcaatgcaaatggcatcggcctactcagct
tatagtgttacaggacaaggcacacaaacttcttacccggacaaagttcaatttgaacag
ttcttacaatctttaaaataa

DBGET integrated database retrieval system