KEGG   Mannheimia varigena USDA-ARS-USMARC-1296: X808_15330Help
Entry
X808_15330        CDS       T03027                                 

Definition
DeoK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mvi  Mannheimia varigena USDA-ARS-USMARC-1296
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    X808_15330
Enzymes [BR:mvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     X808_15330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1630998..1631918
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLISYIEDMPKMGETLEAPDFKIGCGGKGANQAIAAAKLGASVMMITKV
GDDMFAENTIKNFQQYGVNTDFVEKVEGVSSGVAPIFVDQSSQNRILIIKGANACLKPED
IDRAEKQLKVCKLIILQLEIPLETVYYAIDFANKYNIPVILNPAPASKSLDIHYACKCDF
FMPNETELEILTGMPVKTMEQIQEAANCLFAKGLKNLIVTLGEKGSVWFHQDKVTHIPPH
KVNAIDTSGAGDAFIGCFAHFYIQTQNVQQAMQMASAYSAYSVTGQGTQTSYPDKVQFEQ
FLQSLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagtaattggctctaatatggtggatttaattagctatattgaagatatg
ccaaaaatgggagaaacacttgaagccccagactttaaaataggctgtgggggtaaaggg
gctaatcaagctattgcagctgctaaattaggtgcttcagttatgatgatcactaaagtt
ggtgatgacatgtttgctgaaaatacgattaagaatttccaacaatatggtgttaatacc
gattttgttgaaaaagtagagggagtttctagtggtgtagcccctatctttgtagatcaa
tcgtcgcaaaatcgaatcctaattatcaaaggtgcaaatgcttgtttgaaaccggaagat
attgaccgtgcagaaaagcaattaaaagtctgtaagcttattattctacaactcgaaatt
cctttagaaactgtctattacgcaattgattttgccaataaatataacattcctgtaatt
cttaaccctgcaccggcaagtaaatcattagatattcactatgcttgtaaatgtgatttc
tttatgccaaatgaaactgaactagagattctaacaggcatgcctgtaaaaactatggag
caaattcaagaagctgcaaattgtttatttgcaaaaggtttaaaaaatctcattgtaact
ttaggtgaaaaaggttctgtatggttccatcaagataaagtaactcacattcctcctcat
aaggtcaatgctattgatactagcggtgcaggcgatgcctttataggttgtttcgctcat
ttttatattcaaactcaaaatgtacaacaagcaatgcaaatggcatcggcctactcagct
tatagtgttacaggacaaggcacacaaacttcttacccggacaaagttcaatttgaacag
ttcttacaatctttaaaataa

DBGET integrated database retrieval system