KEGG   Mannheimia varigena USDA-ARS-USMARC-1296: X808_19670Help
Entry
X808_19670        CDS       T03027                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mvi  Mannheimia varigena USDA-ARS-USMARC-1296
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    X808_19670
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    X808_19670
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    X808_19670
Enzymes [BR:mvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     X808_19670
Exosome [BR:mvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X808_19670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2086158..2087627)
Genome map
AA seq 489 aa AA seqDB search
MKKLTQLTFSAIAVFYFMVSANAQQAVENTQNSVKAKNVILLISDGAGMQTWNAASYYRH
GTLGKEVYDKFEVKLFASTHSLNTSKQATKSAEGTIKFDSAKLWGNQTSSNIFKGGLGNY
DGYFDGYDYARTDATDSAAAATALATGYKTYNNAINWSNDDTRLKHIGEYVVESGRSLGV
VSSVQWSHATPAGFLAHNQSRNNYAEIAKEIVDSGLATVVMGAGNPYFDENGKSVEPKDD
KAFRFVGGKETWEKLISGQTDYHFIEKKDDFIALAEKRLDLGSKSKVLGTTQTASTTQFS
RKGQTSGNLLDNQPDLPTMTKGALNLVSQNPNGFFLMVEGGAVDWAAHANNLPRIIEEQI
DFNLAVEAAVDWVEKNSSWEETLVIVTTDHGNGLLAGPDSDVNPYSPIINQGAGALPLVR
WHTDNHTRELVPVYANGVGADFFHSVARKEPNLGRVYKAEENSRKYIDNTQIFDAATNAL
GIETSKSKQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaactcaattgactttttccgctattgctgtgttctactttatggtatct
gccaatgcacaacaagcggtcgaaaatacgcaaaattctgtaaaagcgaaaaatgtaatt
ttgttaattagtgatggtgcaggaatgcaaacgtggaatgctgccagttattatcgacac
ggcacattaggcaaggaagtctatgataaatttgaagtaaaattattcgcttcaacccac
tcactaaatacctcaaagcaagctacaaaatccgctgagggcacaataaaatttgattcg
gcaaaattatggggaaaccaaacatcaagcaatatatttaaaggcggtcttggcaattat
gatggctattttgatggttatgattatgccagaaccgatgcaaccgacagtgccgctgcg
gcaaccgcactcgctacgggctataaaacctacaataatgcgattaactggtcgaatgat
gatactcgattaaaacatattggcgaatatgtggtagaaagtggtcgctcactaggtgtt
gttagttcggtacaatggagccacgcaacaccagccggtttcttagcccataaccaaagc
cgcaataattatgcagaaatcgccaaagaaattgtggattcaggcttggcaacagttgtg
atgggagcagggaatccttactttgatgaaaatggaaaatctgttgagcctaaagatgac
aaggctttccgatttgttggcggtaaagaaacttgggagaaattaatttcagggcagaca
gactatcactttattgaaaagaaagatgatttcattgctcttgccgaaaaacgccttgat
ttaggctcaaaatccaaagtattaggcacaactcaaacggcttccactacgcaatttagc
cgtaaaggtcaaacaagcggaaacttgcttgataaccaaccagacttacccacaatgacg
aagggtgcattgaacttagtgagtcaaaatccaaatggctttttcttaatggtagaaggt
ggagcagtggattgggcagctcacgccaataatctaccccgtattattgaagaacagatt
gactttaaccttgccgttgaagcagcggttgattgggttgagaaaaacagttcttgggaa
gaaacccttgtaatagtaactaccgatcacggcaacggcttactggcagggcccgattct
gatgttaatccatactcgccaattatcaatcaaggagctggagcgttaccattagttcgc
tggcatacggacaaccacactcgtgagcttgtgccagtttatgccaacggtgtgggggct
gattttttccacagcgttgctcgcaaagagccgaatttaggacgagtgtataaggctgag
gaaaatagccgtaaatatatcgacaatacgcagatctttgatgccgctacaaatgcacta
ggcattgaaacgagtaaatcaaagcagtaa

DBGET integrated database retrieval system