KEGG   Mannheimia varigena USDA-ARS-USMARC-1296: X808_7600Help
Entry
X808_7600         CDS       T03027                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mvi  Mannheimia varigena USDA-ARS-USMARC-1296
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    X808_7600
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    X808_7600
  Energy metabolism
   00680 Methane metabolism
    X808_7600
Enzymes [BR:mvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     X808_7600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(802138..804738)
Genome map
AA seq 866 aa AA seqDB search
MLGEFLGETIRDAQGDYILDLIESIRILSRNSRSGDESAREQLLEKLANISNDDVLPVAR
AFSHFLNLTNIAEQHQTVSRHHINNSLGSRSLDSLFLRLKSHNIPVEKVIKTVESLMIDL
VLTAHPTEVTRRSLGHKHVEINKCLDLLEHDDLTEAESYKIKRRLMQLIALAWHTNEIRT
QRPTPVDEAKGGMAVIENSLWTAVPEFCRQLNFYLEKHFGVQYPVSLAPVRFSSWMGGDR
DGNPFVTAETTRRVLRMNRWKAAELFLEDIKHLTEELSITQCTPAFRTKYGEHLEPYRVV
LKALRQKLANTEIYYAELLEDKISTIDEAEILTSDNQLWQPLFDCYESLQACGMRIIANG
ALLDCLRRVSCFGLGLSRLDIRQESTRHEMAIAEITRYIGLGDYSHWTEDDKQAFLVREL
SSRRPLLPTNWTPSHETKEVLDTCKIVAEQPKGVISAYVISMAREASDVLAVHLLLKEAG
CKFTIPVAPLFETLGDLDHSEKVMTDLFNIGWYRGVINNYQMVMIGYSDSAKDAGMLAAG
WAQYRAQEALVNLSEKYNIELTLFHGRGGTIGRGGAPAHAALLSQPPRSLKNGLRVTEQG
EMIRFKLGLPAVAVESLELYASAILEANIFPPPEPKQEWRDVLAKGSEISCQIYRNMVRG
EPDFVPYFRAATPEQELSRLPLGSRPAKRNPKGGVESLRAIPWIFAWMQNRLMLPAWLGA
GQALQQLIDDGNEKLLKEMCSEWPFFSTRIGMLEMVFSKADIWLAEYYDQRLVTPNLHRL
GKALRTQLQADLKTVLALAHEGQLMADLPWIAESIALRNVYTDPLNLLQVELLHRIRNQD
ENVNPELEQALMITITGIAAGMRNTG
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgttaggagagtttttaggtgaaactatccgtgatgcacagggagattatattcttgat
ttgattgagagcattcgcatattatcaagaaattcacgctctggcgatgaatctgcacgt
gaacaattattagaaaagctcgctaatatctctaatgatgatgtattacctgttgctcgt
gccttcagccactttttaaacctcactaatattgctgaacagcatcaaacagtttctcgt
catcatattaataactcactaggaagccgttccttagattcacttttccttcgcttaaaa
tcacacaatattcctgttgaaaaagtgatcaaaacggttgaaagcctaatgattgatttg
gtgctcactgctcacccaactgaagtcactcgccgttcgcttggacataagcacgttgaa
attaataaatgtttagatttattagagcacgatgacttaaccgaagcggaaagttacaaa
atcaaacgccgtttaatgcaactgattgcgttagcttggcacactaatgaaattagaaca
cagcgtccaacaccggttgatgaagccaaaggtggtatggccgtgattgaaaacagtcta
tggactgctgtacctgaattctgccgccaacttaatttctatttagagaaacatttcgga
gtgcaataccccgttagccttgctcctgttcgcttctcttcttggatgggcggtgaccgt
gatggtaatccgtttgtaacggctgaaactactcgccgtgtattaagaatgaaccgttgg
aaagcagctgagttatttttagaagatattaaacaccttaccgaagaattatctattaca
caatgtacacccgcttttcgtacaaaatatggcgaacatttagagccataccgtgtcgta
ctgaaagcattacgccaaaaattagctaatactgaaatttactatgcggaactcttggaa
gataaaatatcaactattgatgaagctgaaattttaacttcggataaccaactttggcag
cctctgtttgattgttacgaatccttacaagcctgtggtatgcggattatcgcaaacggt
gcactattagattgtttacgccgtgtgagctgctttggcttaggattatctcgcctcgac
attcgccaagaaagcacgcgtcacgaaatggcgattgcggaaattactcgctacatcggc
ttaggcgattactcgcactggacggaagatgacaaacaagcctttttggtgcgtgagttg
agctctcgccgcccgctgctaccaactaactggacaccaagccatgaaaccaaagaggtg
ttagatacttgtaaaatcgtagcagagcaacctaaaggcgtaatttctgcttatgtgatt
tcaatggctcgtgaagcctcagacgttctagcggtgcatttattgctcaaagaagccggc
tgcaaattcactattcctgttgcaccactatttgaaactctcggcgatttagatcacagt
gaaaaagtgatgaccgatttatttaatatcggctggtatcgtggcgtgatcaacaattac
caaatggtgatgatcggctattccgattctgctaaagatgccggaatgttagctgccggt
tgggctcagtatcgagctcaagaagccttagtgaatttaagtgaaaaatacaacattgaa
ttgacactgttccacggacgtggtggtactatcggacgtggcggtgcaccagctcacgct
gctctactttctcagccacctcgctcattgaaaaacggtttacgagtgactgaacaaggt
gaaatgatccgcttcaaattgggcttgcctgcggtagcagtagagagtttagaactctac
gccagtgcgattttggaagcgaacattttcccaccgccagaacccaaacaagagtggcga
gatgtattagcaaaaggctcggaaatttcgtgccaaatttaccgcaatatggtacgtggc
gaacctgatttcgtaccgtatttccgagccgcaacgccagagcaagagctttctcgctta
ccacttggctcacgccctgcaaaacgtaacccgaaaggtggtgttgagagtttaagagct
attccgtggatttttgcttggatgcaaaaccgcttaatgcttcctgcgtggttaggtgcg
ggacaagcattacagcaactcattgatgatggtaacgaaaagctattaaaagagatgtgc
agtgaatggccgttcttctcaactcgtataggaatgcttgaaatggtattcagtaaagca
gacatttggttagcggaatattacgatcaacgtttagttacaccaaacttgcatcgttta
ggcaaagcactacgcacgcaattacaagccgatctcaaaaccgtactggctcttgctcac
gagggtcaattaatggcagatttaccttggattgcagaatctatcgctctgcgtaatgtg
tacaccgatccgctcaacctactacaagtagaactattacaccgtattcgtaatcaagac
gaaaatgtcaatcctgaattagagcaagccttaatgattactatcacaggtattgcggca
ggtatgcgtaatacagggtaa

DBGET integrated database retrieval system