KEGG   Methanococcus vannielii: Mevan_0155Help
Entry
Mevan_0155        CDS       T00554                                 

Definition
(RefSeq) type III restriction protein res subunit
  KO
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mvn  Methanococcus vannielii
Brite
Enzymes [BR:mvn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Mevan_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
178381..181410
Genome map
AA seq 1009 aa AA seqDB search
MKHLHYKKQDFQEHAVNAVCDIFEGEMGAVSKYILDKEKSNLKDWTGTDKNIYAFRNEKI
NLSNELLLKNINEIQKRNGIFGSEVAESMDKANLNITIEMETGTGKTYTYINTIFELNKR
YNWTKFIIVVPSIAIREGVYKSFEDMEEHFLAIYGKKINYFVFNSSKINDVMSFARDDGI
NVMIINNQAFNKTESNTIHNSNNEYGVAPIEYINTTNPIMIIDEPQSVEGKGKTKTKDVL
SEFKPLFTLRYSATHRELYTLVYRLDAVDAFNKKLVKRIEVKGIEVKGGNATHGYFLVDE
ILTSKGNPKARIEIDISTSKRQLKKVEDGDNIYEKYAQLEQYKDWVIDKVDGRNNCVVVR
TPEGDKTFDQGVIYGKPDKMYQRRIQIRELIKSHLNKESMNYKNGIKTISLFFIDEVAKY
RQYADDGNQVNGEYAEIFVQEYTSIISEFLEENPELNDYLGKISVDDTHKGYFSIDKKSK
QLKNPDLKGKGKEKTCSDPDTFELIMKDKKRLLDLKNPVRFLFSHSALKEGWDNPNVFQI
CILRDNESTEIKRRQEVGRGLRLCVNQNGERIDSSFEGIDVDKTNVLTIIANESYESFAN
ALQSEFNESLKIRPTKFSVEFLKTQNINGTQISPDLANKIHYSFVINQYLTEDNEFTEKF
RTDLETNDIKISESLKEYSKEIIELSKKVVNNKIDISKASGKSDVRSHIKLEKLNDPEFD
KLWNYISTKSYYTVDFDTKELIKNSVAKINEKLTVSSVYVELRTGITKKEHENTVEFEEK
KLDTISVENAISKNIKFDLISQIVDKTRLTKNTIIEILTNITQEKFECFKKNPEEFIKNI
SNLINHEKAVIIENNIVYHKADEKIPKDIFENILKLNPEKYIETPNNYLYDKLEYDSVDP
EKKIGEEMDIYNNLIVFTKLPKNKYNIETPVGKFSPDWLMVFKKDTVSHAYCVFESKGSL
VEADRREIENIKIDCAKKHFSAISNEKIIFDAVTSVDNVIDSIKPKATV
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttgcattataaaaagcaggactttcaagaacatgcagtaaatgcagtctgc
gatatttttgaaggggaaatgggtgcagtttcaaaatatattttggataaagaaaaatca
aatttaaaagactggactggaaccgacaaaaatatctacgcatttagaaatgaaaaaatt
aatctttcaaatgaactccttttgaaaaacataaatgaaattcaaaaaagaaatggtatt
tttggaagtgaagttgctgaatcaatggataaagctaatttaaatataactattgaaatg
gaaactggaactggaaaaacctatacatacattaatacaatttttgaattgaataaaaga
tacaactggactaaatttattatcgtagttccaagtatcgcaattcgagaaggtgtttat
aaatcatttgaagatatggaagaacattttttagcgatatatggtaaaaaaataaattat
tttgtattcaattcatcaaaaataaacgatgtaatgagttttgcacgagatgacggaatt
aatgtaatgattatcaataatcaggcttttaataaaactgaaagtaatacaatacataat
tctaataatgaatatggtgttgcacctattgaatacatcaataccacaaacccgataatg
ataattgacgaaccccaatctgttgagggtaagggaaaaaccaaaacaaaagatgtttta
agcgaatttaaaccattatttactttaaggtactctgcaacacatagggaattatatacg
cttgtttacaggttagatgcagtagatgcatttaacaaaaaactggttaaacgaattgaa
gttaagggaattgaagttaaaggtggaaatgcaacacatggctactttttagtcgatgaa
atattaaccagcaagggtaacccaaaagcaagaattgaaattgatatttcaacatccaaa
agacagttaaaaaaagtagaggatggcgacaatatttatgaaaaatatgcacaattagaa
caatataaagattgggttatcgataaagttgacggaagaaataattgtgttgttgtaaga
acacctgaaggagataaaacatttgatcaaggcgtaatttatggaaaacctgataaaatg
tatcaaagaagaattcaaattagggaattgataaaatcccacctaaataaagaatctatg
aattacaaaaacgggataaaaacaatatctcttttctttattgacgaagttgcaaaatat
agacaatatgctgatgacggaaatcaagtaaatggtgaatatgctgaaatttttgttcag
gaatatacttcaataatttcagaatttttagaagaaaatcccgaattaaatgattatttg
ggaaaaatttcagtagatgatacacataaaggatacttttcaattgataaaaaatctaaa
caacttaaaaatccagatttaaaaggtaaggggaaagaaaaaacttgtagtgaccccgat
acttttgaattaattatgaaagataaaaaaagactgcttgatcttaaaaacccagtccgg
tttttgttttcccactcagcacttaaagaaggttgggataacccaaacgttttccaaatt
tgtatattaagagataatgaatctaccgaaataaaacgaagacaagaagtcggccgtggg
ttaagactttgtgtaaaccaaaatggggaaagaatagacagtagttttgaaggaattgat
gtagataaaacaaatgtacttacaattattgcaaatgaatcttatgaatcctttgcaaac
gcattgcagtcagaatttaatgaaagtttaaaaattaggcctactaaatttagtgtcgaa
ttccttaaaacccagaatattaatggaacacaaatatctccggatttagcaaataaaatt
cactattcatttgtaataaatcagtatttaactgaagataatgaatttacggaaaaattc
agaactgatttggaaactaacgatataaaaatctctgaatcattaaaagagtattctaaa
gaaattattgaactatctaaaaaagtagtaaacaataaaatagatataagtaaggcatct
ggaaaatcggacgtacgatcacacataaaacttgaaaaattaaatgatcccgaatttgac
aaattgtggaattatataagtactaaaagttattacacagtggattttgatacaaaagaa
ttgattaaaaattcagtagctaaaatcaatgaaaaattgactgtaagttcagtatatgta
gaattacgtaccggaataacaaaaaaagaacatgaaaatactgttgaatttgaagaaaaa
aagttagatactatttcagtagaaaatgccatctcaaaaaacattaaatttgatttaatt
tcacagattgttgacaaaacaaggcttacaaaaaatacaattattgaaatattaaccaat
ataacgcaggaaaaatttgaatgttttaagaaaaatccggaagaatttataaaaaatatt
tcaaatttgataaatcacgaaaaagcagtaatcattgaaaataatatcgtataccataaa
gctgatgaaaaaattccaaaagatatttttgaaaatattttaaaattaaaccctgaaaag
tatattgaaacgccaaataattatctttatgataagttagagtacgattcagtggatcca
gaaaagaaaataggggaagaaatggatatttataataatctaatagtatttacaaaactt
cctaaaaataaatacaatattgaaacaccagttggtaaatttagtccggattggttaatg
gtatttaaaaaagatactgtttcgcacgcttactgtgtttttgaatctaaaggaagttta
gttgaagctgaccggcgagaaattgaaaatataaaaatagactgtgcaaaaaaacatttt
tcagcaatatcgaatgaaaaaattatatttgatgcagttaccagcgtagataatgtaatt
gactctataaaaccaaaagctacagtatag

DBGET integrated database retrieval system