KEGG   Methanococcus vannielii: Mevan_0244Help
Entry
Mevan_0244        CDS       T00554                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00010  Glycolysis / Gluconeogenesis
mvn01100  Metabolic pathways
mvn01120  Microbial metabolism in diverse environments
mvn01200  Carbon metabolism
mvn01230  Biosynthesis of amino acids
Module
mvn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mvn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mevan_0244
Enzymes [BR:mvn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Mevan_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: ABR54153
JGI: Mevan0244
UniProt: A6UNT1
Position
complement(288049..289887)
Genome map
AA seq 612 aa AA seqDB search
MNILIDAKEQNYSIIEGEYFPLSFGMMMHETHETWKYNPFDEKNLFCFGRGILPVIGGHR
LIFSFRSPLWDGFHFSAMGGAGYTFKDTGVSNVAITGKCSIPSLIVINGEEENLKVDFIP
FNDKIESIYEFNEKIIDKFKEKNYRAFLVGPASKTTNMGAIYSHTIKNGKAVEGSEDWAA
RGGGGSVLFQAHNIVGVVFFGKKRPEKDLRHIVEEHFKKPYTKVVLENTEKYRYSEEKKT
GGTFGNNYHITMELTPIFNWRMPFIDKNKRFKLHRKILKHFVKNFDIEAIETKNWTNCGE
PCPTVCKKHRNGLHVDYEPYEANGPLLGIFDIYAADKVVNMVDTIGIDAIEFGNLCSWVF
ELLDNGMLKPEEVGIEKPVFDIESFENDEDILKNSEHNAKQAVAFAKIVAFNENEFGNLC
SRGVRRASKVLNEKYPERIKDRKFEDFGVYDSFGKEGQISPTMYWAIGNFMPYLIQGKYL
THYQCGVFLEPEELAKLSVKNTLEEIMLENLGICRFHRKWITPIIDKLLKEVSDIDIFFE
SKKLLKDISKYDSNIGYPTMESKRVEELIISGANEFENEKWSKEFEKGNFNEYIKRVVKK
YEELLEIDWKIK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttgattgatgcaaaggaacaaaattattctataattgaaggagagtacttc
ccactttcatttggtatgatgatgcatgaaacacatgaaacgtggaaatataatcctttt
gacgaaaaaaatcttttctgttttggcagaggaattttacccgtaattggcggccatagg
ctaatattttcatttagatcaccactttgggatggattccatttttcggcaatgggtgga
gcaggatatacatttaaagatacaggagtttcaaacgttgcaattactggaaaatgtagt
atcccaagtttaatcgttataaacggggaagaagaaaatttaaaagtagattttatccca
tttaacgataaaattgaaagtatttacgaatttaatgaaaaaattattgataaattcaaa
gaaaaaaattaccgtgcatttttagttggccctgcttcaaaaacaacaaatatgggtgca
atatactcacacactattaaaaatggaaaagcagttgaaggttcagaagactgggctgca
agaggcggaggtggttccgtactatttcaagcccataatatagtaggcgttgtttttttc
ggtaaaaaaaggcctgaaaaagatttaagacatattgtagaagaacactttaaaaaacca
tatactaaagtagttttagaaaatactgaaaaatatagatatagtgaagaaaaaaaaaca
ggcggaacttttggaaataattatcatattacaatggagctaactccaatttttaactgg
agaatgccatttattgataaaaataaacgatttaaattgcacagaaaaatattaaagcat
tttgtgaaaaatttcgatattgaagcaattgaaactaaaaactggacaaattgtggagaa
ccctgcccaacagtctgtaaaaaacatagaaatggattacacgtggattacgaaccttat
gaagcaaacgggccattgcttggaattttcgatatttacgccgctgataaagttgtaaat
atggtggataccattggaattgatgcaattgaatttggaaacctttgttcatgggtattt
gaacttttagataatggaatgttaaaacccgaagaagttggaattgaaaagccagttttt
gatattgaaagctttgaaaatgacgaagatatcttaaaaaattcagagcataatgcgaaa
caggccgtagcttttgcaaaaattgttgcattcaatgaaaatgaatttggaaacctttgt
tcccgtggagttaggcgagcatcaaaagtactaaatgaaaaatatcctgaaaggataaaa
gatagaaagtttgaagactttggagtatatgattcttttggaaaagaagggcagatttcg
ccaacaatgtattgggcaattgggaactttatgccgtatttaatacagggaaagtactta
acacactaccaatgcggagtatttttagaacctgaagaattggccaaattaagtgttaaa
aatactcttgaagaaataatgcttgaaaatcttggaatatgtagattccatagaaaatgg
attactccaataattgacaaacttttaaaggaagtaagtgatattgacatattttttgaa
agtaaaaaattattaaaagatatatcaaaatacgattcaaatattggttatcctacaatg
gaaagtaaacgtgtagaagagctaataatttcgggtgctaatgaatttgaaaatgaaaaa
tggtcaaaagaatttgaaaaaggaaacttcaatgagtatattaaacgagtcgtaaaaaaa
tatgaagagttacttgaaatagattggaaaattaaatag

DBGET integrated database retrieval system