KEGG   Methanococcus vannielii: Mevan_0327Help
Entry
Mevan_0327        CDS       T00554                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mvn  Methanococcus vannielii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mevan_0327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mevan_0327
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mevan_0327
Enzymes [BR:mvn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mevan_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(376401..377180)
Genome map
AA seq 259 aa AA seqDB search
MNKPVLVSFLVSGDPNADATLKFMKALDKYSGVIELGIPFSDPVADGATIQAADVRALSN
GFKIAKSFEILKEFRKESNTPVILMTYYNPVYNRGIENFVTQAKEAGANGLIIVDLPLQE
ATEYRKICKKHEMGTVFLSAPNTPEERLKMSDEASTEFLYLISTFGITGARESFEQMTFD
FIKRARKTCKGKICVGFGISKGTHAESLIEQGADGVIVGSAFVDIIKTYGDSNEAITKLE
ELAKELHNGIEKGFEKRNK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacctgtattagttagttttttagtttccggggacccaaatgcagacgcaacg
ttaaaattcatgaaagcacttgataaatattctggcgtaattgaactcggaattccattt
agcgaccccgttgcagatggagctacaattcaggcagcagatgtcagggcattatcaaac
ggctttaaaattgctaaatcctttgaaatattaaaggaatttagaaaagagtcaaatact
cccgtaattttgatgacttactataatccagtatacaaccggggaattgaaaactttgta
actcaggcaaaagaagcaggagcaaacggccttattattgttgatttaccgctacaggaa
gcaacagaatatcgaaaaatctgtaaaaaacacgaaatgggaacggtatttctttcagca
ccgaacacgccagaagaacgtttaaaaatgtcagacgaagcaagtactgaatttttatac
cttatttcaacattcgggataactggtgcaagggaatcgtttgaacagatgacatttgac
tttatcaaaagggcgagaaaaacttgtaagggaaaaatctgtgttggatttggaatttca
aaaggaactcacgctgaaagcttgattgaacagggtgctgatggagtaatcgttggaagt
gcttttgttgatattattaaaacatacggggactctaatgaagcgattactaaattagaa
gagctcgcaaaagagttgcataatggaatcgaaaaaggatttgaaaaaagaaataaataa

DBGET integrated database retrieval system