KEGG   Methanococcus vannielii: Mevan_0328Help
Entry
Mevan_0328        CDS       T00554                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mvn  Methanococcus vannielii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mevan_0328
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mevan_0328
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mevan_0328
Enzymes [BR:mvn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mevan_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(377181..378365)
Genome map
AA seq 394 aa AA seqDB search
MKCEGYFGEFGGQFIPEVLMPAIDELKEAYFELKDDEDFQNELSYYLKHYAGRETPLYYA
ENLTKKLGGAKIYLKREDLLHGGAHKTNNTIGQALLAKRMGKKRIIAETGAGQHGVGTSM
AGALFGLETEIFMGRLDTERQQPNVFRMKLLGAKVTPVDTGSKVLKDAVNEAMRNWTATF
ENTHYLIGTVMGPHPFPTIVRDFQSVIGKEVKKQMTEQEGRFPDYLVACIGGGSNALGLF
HAFIPDKEVKMIGIEAAGKGLDTSLHGASISKGKKGVLHGMLSYFLQDEDGQIEEAYSIS
AGLDYPGIGPEHAYLHNSGRAEYASATDEQALNALMELTRSEGIIPALESSHAVAYAIEN
AGTMDKDDIMVINLSGRGDKDLNTVIDIMQKRGM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtgaaggatactttggagaatttggtgggcagtttatccctgaagttttgatg
cctgcaattgatgaactaaaagaagcgtattttgaattaaaagacgatgaagattttcaa
aatgagctttcttactatttgaaacattatgccgggcgtgaaactccgctttactacgct
gaaaacctgactaaaaagcttggaggtgcaaaaatctacttaaaacgggaagatttgctt
cacggcggggctcacaaaacgaataacactattggtcaggcattacttgctaaaagaatg
ggcaaaaaaagaataattgcagaaactggtgccgggcagcacggtgttggaacttcgatg
gcaggagcactatttggacttgaaacagaaatttttatggggcgccttgatactgaaaga
cagcaaccaaacgtatttagaatgaaacttctcggtgcaaaggtaactcctgtagatact
gggtcaaaagtattaaaagacgctgtaaacgaagcaatgagaaactggactgcaactttt
gaaaacacgcactatttaatcggaactgttatggggccacatcctttcccgactattgta
agggatttccagtccgtaataggaaaagaggttaaaaaacaaatgacggaacaggaagga
aggtttcccgactatttagttgcatgcattggtggcggaagtaatgcacttggtttattc
cacgcatttattccagataaggaagttaagatgatcggaattgaagcagctggaaaaggc
cttgatacaagcttacacggtgcatctatttcaaaaggaaaaaaaggagttcttcacgga
atgctttcgtactttttacaggatgaagatggtcaaatcgaagaagcatacagtatttcg
gcaggactagattaccccggaattggccctgaacatgcatatttacacaattctgggcga
gcagaatacgcatcagcaactgatgaacaggcattaaatgcacttatggaacttacaaga
agtgagggaataattccagctctggaatcatcacatgcagtagcttatgcaattgaaaat
gcgggaaccatggataaggatgatataatggtcataaacctttcagggcgtggcgacaag
gatttaaacacggtaattgacataatgcaaaaaagagggatgtaa

DBGET integrated database retrieval system