KEGG   Methanococcus vannielii: Mevan_0328Help
Entry
Mevan_0328        CDS       T00554                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00260  Glycine, serine and threonine metabolism
mvn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mvn01100  Metabolic pathways
mvn01110  Biosynthesis of secondary metabolites
mvn01130  Biosynthesis of antibiotics
mvn01230  Biosynthesis of amino acids
Module
mvn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mevan_0328
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mevan_0328
Enzymes [BR:mvn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mevan_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABR54237
JGI: Mevan0328
UniProt: A6UP15
Position
complement(377181..378365)
Genome map
AA seq 394 aa AA seqDB search
MKCEGYFGEFGGQFIPEVLMPAIDELKEAYFELKDDEDFQNELSYYLKHYAGRETPLYYA
ENLTKKLGGAKIYLKREDLLHGGAHKTNNTIGQALLAKRMGKKRIIAETGAGQHGVGTSM
AGALFGLETEIFMGRLDTERQQPNVFRMKLLGAKVTPVDTGSKVLKDAVNEAMRNWTATF
ENTHYLIGTVMGPHPFPTIVRDFQSVIGKEVKKQMTEQEGRFPDYLVACIGGGSNALGLF
HAFIPDKEVKMIGIEAAGKGLDTSLHGASISKGKKGVLHGMLSYFLQDEDGQIEEAYSIS
AGLDYPGIGPEHAYLHNSGRAEYASATDEQALNALMELTRSEGIIPALESSHAVAYAIEN
AGTMDKDDIMVINLSGRGDKDLNTVIDIMQKRGM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtgaaggatactttggagaatttggtgggcagtttatccctgaagttttgatg
cctgcaattgatgaactaaaagaagcgtattttgaattaaaagacgatgaagattttcaa
aatgagctttcttactatttgaaacattatgccgggcgtgaaactccgctttactacgct
gaaaacctgactaaaaagcttggaggtgcaaaaatctacttaaaacgggaagatttgctt
cacggcggggctcacaaaacgaataacactattggtcaggcattacttgctaaaagaatg
ggcaaaaaaagaataattgcagaaactggtgccgggcagcacggtgttggaacttcgatg
gcaggagcactatttggacttgaaacagaaatttttatggggcgccttgatactgaaaga
cagcaaccaaacgtatttagaatgaaacttctcggtgcaaaggtaactcctgtagatact
gggtcaaaagtattaaaagacgctgtaaacgaagcaatgagaaactggactgcaactttt
gaaaacacgcactatttaatcggaactgttatggggccacatcctttcccgactattgta
agggatttccagtccgtaataggaaaagaggttaaaaaacaaatgacggaacaggaagga
aggtttcccgactatttagttgcatgcattggtggcggaagtaatgcacttggtttattc
cacgcatttattccagataaggaagttaagatgatcggaattgaagcagctggaaaaggc
cttgatacaagcttacacggtgcatctatttcaaaaggaaaaaaaggagttcttcacgga
atgctttcgtactttttacaggatgaagatggtcaaatcgaagaagcatacagtatttcg
gcaggactagattaccccggaattggccctgaacatgcatatttacacaattctgggcga
gcagaatacgcatcagcaactgatgaacaggcattaaatgcacttatggaacttacaaga
agtgagggaataattccagctctggaatcatcacatgcagtagcttatgcaattgaaaat
gcgggaaccatggataaggatgatataatggtcataaacctttcagggcgtggcgacaag
gatttaaacacggtaattgacataatgcaaaaaagagggatgtaa

DBGET integrated database retrieval system