KEGG   Methanococcus vannielii: Mevan_0416Help
Entry
Mevan_0416        CDS       T00554                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mvn  Methanococcus vannielii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mevan_0416
   00052 Galactose metabolism
    Mevan_0416
   00500 Starch and sucrose metabolism
    Mevan_0416
   00520 Amino sugar and nucleotide sugar metabolism
    Mevan_0416
Enzymes [BR:mvn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mevan_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(470101..470949)
Genome map
AA seq 282 aa AA seqDB search
MLKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLASAGIESILVITGRGKS
AIENHFDKNFELEERLKKDEKCEALKTIQEINDFAHIYYIRQGKQKGLGDAVYCGREFIC
EDYTVIMVGDTIYSGNVPKKLIEIHEKYGCSVIALERVPKENVHKYGVISGKEIEKGIFE
IDDLVEKPKVEEAPSNLIITGAYLLSSKIFKHLENTEPGRGGEIQLTDAMKMLLKEEKII
GVEVDFKRYDIGDIKGWLEANVELGIDNIDGFKEYIQDLCNK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaaagctatcatacctgccgcaggatttggaacaaggcttcttccaattaca
aaggcgcaaccaaaagaaatgcttccagttttaggaaaaccaataattcaatacgtaatt
gaagatttggcaagtgcaggaatagaaagtatacttgtaattacgggtaggggaaaatct
gcaattgaaaaccactttgataaaaattttgaacttgaagagcggttaaaaaaagatgaa
aagtgtgaagctttaaaaacaattcaggaaataaatgattttgcacatatttattatatc
aggcagggaaaacaaaaaggattaggggacgcagtttactgtggaagggagtttatctgc
gaagactatacagttataatggttggagatacgatatattcaggaaacgttccaaaaaaa
ttaattgaaatccatgaaaaatacggctgttcagtaatcgctttagaacgagttccaaaa
gaaaatgtacataaatacggcgtaatttctggaaaagaaattgaaaaaggaatttttgaa
atagatgaccttgtagaaaaaccaaaagtagaagaagccccatctaaccttataattact
ggagcatatcttttatcttcaaaaatatttaagcaccttgaaaatactgaacctggaagg
ggaggggaaatccaacttactgatgcaatgaaaatgcttttaaaagaggaaaaaataata
ggcgttgaagttgattttaaacggtatgatattggagacattaaaggatggcttgaggca
aacgttgaacttggaattgataacattgacgggtttaaagagtacattcaagatttgtgt
aataaataa

DBGET integrated database retrieval system