KEGG   Methanococcus vannielii: Mevan_0430Help
Entry
Mevan_0430        CDS       T00554                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mvn  Methanococcus vannielii
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mevan_0430
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mevan_0430
   00640 Propanoate metabolism
    Mevan_0430
   00660 C5-Branched dibasic acid metabolism
    Mevan_0430
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mevan_0430
Enzymes [BR:mvn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mevan_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
483776..484864
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKRIFNENGIPIPKGIVTKTKLEDIEGPVVIKAQVLVGGRGKAGGILFADTLN
EANSKIESLIGKEVKGEHVESLLIEEKIKILKEYYVGVVVDRNEKNNVVIFSTEGGVDIE
EIARTSPEKIIKYPVEAGSEFLPYNARNMLKKAGLSSEEIPKVADIICKVYSAFKKMDGV
LAEVNPLVITSEGKILAADAVLNVDDDAYFKHSYMEFEEFKKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDVVKEFGGNPACFLDIGGGATREIVKSALLKATARNSVKGAFINILGGI
TRCDEVSKGIVDVLKEKPELKFAVRMMGTNEKEGREILTKNNVSYENSMEDAAKALTKII
NN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatacgaagcaaaaagaattttcaatgaaaatggaatacccatacca
aaaggaattgttacaaaaactaaattagaggatattgaaggcccagttgtaattaaagca
caagttttagttgggggaaggggtaaagcaggcggaattttatttgcagatacattaaat
gaagcaaattcaaaaatagaatctttaattggaaaagaagtgaagggtgaacatgtagag
tcgcttttaattgaagaaaagattaaaatcttaaaggaatactatgttggagttgtagtt
gatagaaatgagaaaaataacgtagttatcttttcaactgaaggcggggtagatatcgag
gaaattgcaaggacgtcccctgaaaaaattataaaataccctgttgaagcaggtagtgaa
tttttaccctacaatgcaagaaatatgcttaaaaaagcaggtttaagttctgaagaaata
ccaaaagttgcagatataatatgtaaggtatattctgcatttaaaaaaatggatggagta
cttgcagaagtaaatccgcttgtaattacaagtgaagggaaaattctagctgcagatgct
gttttaaatgttgatgatgatgcatactttaaacattcttacatggaatttgaagaattt
aaaaaacaagaaaagtcagaatttgcatacgttgagctcgatggagatattgcagttata
gggaacggtgctgggcttacacttgctagtatggacgttgtaaaggaatttggtggaaat
cctgcatgcttcttagatattggcgggggggccacaagagaaattgtaaaaagtgcactt
ttaaaggctactgctagaaatagtgttaagggcgcatttataaacatccttggaggaatt
acaaggtgtgatgaagtttcaaagggaatagtagatgttttaaaagaaaagccggaactt
aaatttgcagtaagaatgatgggaaccaatgaaaaagaaggaagggaaatactaacgaaa
aacaatgtaagttatgaaaattcaatggaagatgccgcaaaagcacttacaaagataata
aacaattaa

DBGET integrated database retrieval system