KEGG   Methanococcus vannielii: Mevan_0441Help
Entry
Mevan_0441        CDS       T00554                                 

Definition
(GenBank) Cellulase
Organism
mvn  Methanococcus vannielii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
493136..494188
Genome map
AA seq 350 aa AA seqDB search
MNTIDYLKVLATEPGISGREDKIREYMKKELEKYCNSVETDKLGNLIAKKGTIGPKIMIA
AHMDEIGLMVKYIDDKGFLKFAKIGGINDQMLLNQKVIVHSDNGDIVGVLGSKPPHKMKE
SEKNKLISSEHMFIDIGAKNKEDAEKMGVQIGTPISFKSEFEKLGGNAVSCKAFDNRAGC
AVLLKVIEELSKTDLKCQVYAVGTVQEEVGLKGAKTSSYGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIIDASGRGIITHSQVLKMVRDVSKSKEIPVQYEVGEGGTTDATS
IHLTKTGIPTGVLSVPARYIHTPVEVIDLNDLEKTAELVLECIKQVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaattgactatttgaaagttcttgcaactgagcccggaatttccggaagagaa
gataaaataagagaatatatgaaaaaagagctcgaaaaatactgcaatagtgttgaaaca
gataaacttggaaatttaattgctaaaaaaggaactattggcccaaaaataatgattgca
gcgcatatggatgaaatcgggctcatggtaaaatacattgatgacaagggatttttaaaa
tttgcaaaaatcggtggaattaacgatcaaatgcttttaaaccagaaagtaatcgtccat
agtgataatggggatattgttggagtacttggttcaaaacctccccataaaatgaaagaa
agtgaaaaaaataaattaataagttcagaacatatgtttattgatattggcgctaaaaat
aaagaagatgctgaaaaaatgggggttcaaataggaactccaatttcttttaaatccgaa
tttgaaaaattaggtggaaatgctgtttcatgtaaggcatttgataacagagcaggttgt
gcagttcttttaaaggttatagaagaattaagtaaaactgatttaaagtgtcaggtgtat
gctgttggtactgtacaggaagaagttggtttaaaaggtgcaaaaacatcttcctatgga
ataaatcctgatgttgcatttgctcttgatgttacaatttgtggagaccatcctggaatt
aaattagaggatgcaccagttgaacttggaaaaggccctgttgcaacaattattgatgca
tctggaagaggaattataacccattcacaagttttaaaaatggtaagggacgtttcaaaa
tcaaaagaaattccagtacagtacgaagtaggggaaggtggaaccactgatgccacgtca
atccaccttacaaaaacaggtattccaacaggagttctttcagttcctgcaagatatatt
catactccagtagaagttatagatttaaacgaccttgaaaaaactgctgaattagtatta
gaatgtattaaacaggttcatgagtacttttaa

DBGET integrated database retrieval system