KEGG   Methanococcus vannielii: Mevan_0503Help
Entry
Mevan_0503        CDS       T00554                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mvn  Methanococcus vannielii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mevan_0503
Enzymes [BR:mvn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mevan_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
551311..551856
Genome map
AA seq 181 aa AA seqDB search
MDLKEFIKICHLLYDRKYVVGSGGNVSLKKDNLVYITPTGSILGFLNEEDICVVDIAGKI
IKGKPTSELNMHLEIYRNKPHVNAVVHTHSMYCTAFSVLDKKLELYTPEAEIFLKKIGYV
DYCPCGTLELAECVSSCNEDVLILKKHGIVTLGSTLTEAYIKTEVLEEIAKLNHIVMSFD
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttggatttaaaagaatttataaaaatatgccatttattatatgatagaaaatatgtagtt
ggctcaggcggaaacgttagtttaaaaaaagataatttagtatacataacgccaacaggg
tctattttaggttttttaaatgaggaagatatttgtgttgttgatattgctggaaaaatt
ataaaaggaaagcctacttcagaattaaacatgcatttagagatttatagaaataaaccg
cacgtaaatgcagtcgttcatacgcattcaatgtactgtactgcattttcagttttagat
aagaaattagaactttatacgcctgaagctgaaattttccttaaaaaaataggttacgtt
gactactgcccttgcggaacgttagaacttgcagagtgcgtctcttcgtgtaatgaagac
gttttaatattgaaaaaacacggcatagttacgcttggaagtactttaactgaagcatat
attaaaacagaagttttggaagaaattgccaagttaaatcatatagtaatgtcttttgat
aaataa

DBGET integrated database retrieval system