KEGG   Methanococcus vannielii: Mevan_0558Help
Entry
Mevan_0558        CDS       T00554                                 

Definition
4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mvn  Methanococcus vannielii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mvn01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mvn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
609824..610279
Genome map
AA seq 151 aa AA seqDB search
MPEHLLSGIKAIVAINMRKEGMLQREIADFLKMDRSIISHYLHGRYPSDKVMRVSEEIIR
LPLEYGIPLITSLGDDKEITKKLVERIYKITIEIDMEKCIACGNCLECEYDAISVYSEDI
GISIDKEKCVLCLQCVSECPVNALKITNYKV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatttactgtcaggtatcaaagcaattgtcgcaataaatatgcgaaaagag
ggaatgctgcaaagagaaatagcggattttctcaaaatggatcgttcaatcatttcacac
tatttacatggcagatatccatctgataaagtcatgcgagtctctgaagagattataagg
ttaccccttgaatatggaattccattgatcacgtctcttggtgatgacaaagagattaca
aaaaaattagtagaacgaatttataaaataactatagaaattgacatggaaaaatgtatt
gcgtgtggtaattgtttagaatgtgaatacgatgcaatatcggtttattcggaagatata
ggcatatctattgataaagaaaagtgcgttctttgtctacagtgtgtttccgagtgccct
gtcaatgccttgaaaataactaactacaaggtataa

DBGET integrated database retrieval system