KEGG   Methanococcus vannielii: Mevan_0709Help
Entry
Mevan_0709        CDS       T00554                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mvn  Methanococcus vannielii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mevan_0709
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mevan_0709
Enzymes [BR:mvn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mevan_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
762961..764208
Genome map
AA seq 415 aa AA seqDB search
MKSIFDETVDISSNLIKINSVNPSFEGPGEEEKTKYIKNKLEEYVKKYGIDNFQILNYNI
KDENNILRPNIVSKFNFSKDKTLTIISHTDVVPIGDIGLWDTDPFEPIISDNVIYGRGCE
DNHKGIVSSFLLLKMIFEEQIDPKYNLNLIFVSDEENGSKYGLSYLVDNFEKELFNKDDL
IIVPDFGVFDGNLIEIAEKKIMWIKFKIKGKQCHGSTPENGLNADVLAFKFGEGLYCKLY
KKYNNINSIFTPPFSTFEPTMLKNNVENTNTIPGYVELNFDCRILPEYDINDVLADIDEY
IKLFKNEFEKYLFHYDLKEKDNLEITYDILKIETSTPTKPESKIVTKLESAIKTVLKKEP
KVCGMGGGTVAAFLREKGYPVAVWGIGYETAHQPNEHIKVEQLIDMAKVYLDIMK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtatttttgacgaaacagttgatatttcttcaaaccttataaaaataaattcg
gtaaatcctagttttgaagggcctggagaagaagaaaagacaaaatacataaaaaacaaa
cttgaagaatacgtaaaaaaatatggtatcgataatttccagattttaaattataatata
aaagatgaaaataacattttaagaccaaatatcgtttcaaaatttaatttttcaaaagat
aagacactaacaataatatcacatactgatgttgttccaatcggggatattggcctttgg
gatacagatccatttgaaccaattatttcagataacgtcatctatggtcgaggctgtgaa
gataaccataagggaattgtttcgtcttttttacttttaaaaatgatttttgaggaacaa
attgaccctaaatataatttaaatttgatttttgtgtctgatgaagaaaatggcagtaaa
tacgggctttcatacttagtcgataactttgaaaaggaactttttaataaagacgattta
ataattgttccagattttggagtttttgatggaaatttgattgaaattgctgaaaagaaa
attatgtggattaaatttaaaataaaaggaaagcagtgtcatggaagtactccagaaaac
ggcctaaatgctgatgttttagcatttaaatttggagagggactatactgcaaactatac
aaaaaatacaataatatcaattcgatatttacgcctccattttcaacatttgagccaact
atgttaaaaaataatgttgaaaatacaaatacgataccaggatatgtagaactaaatttt
gactgtagaattcttccagaatatgatataaatgatgttcttgccgatatagatgaatat
atcaaattatttaaaaatgaatttgaaaaatacctcttccactatgatttaaaggaaaaa
gataatttagaaattacctatgatatcttaaaaatagaaacttcaacccctacaaaaccc
gaatcaaaaatagtaacaaaattagaatctgcaattaaaacggtgcttaaaaaagagcca
aaagtatgtggaatgggagggggaactgttgctgcatttttaagggaaaaaggttatcct
gttgcagtatgggggatagggtatgaaaccgcacaccaaccaaatgaacatattaaagta
gaacagttaatagatatggcaaaagtctatcttgatataatgaaatag

DBGET integrated database retrieval system