KEGG   Methanococcus vannielii: Mevan_0815Help
Entry
Mevan_0815        CDS       T00554                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00010  Glycolysis / Gluconeogenesis
mvn00020  Citrate cycle (TCA cycle)
mvn00620  Pyruvate metabolism
mvn00633  Nitrotoluene degradation
mvn00640  Propanoate metabolism
mvn00650  Butanoate metabolism
mvn00680  Methane metabolism
mvn00720  Carbon fixation pathways in prokaryotes
mvn01100  Metabolic pathways
mvn01120  Microbial metabolism in diverse environments
mvn01130  Biosynthesis of antibiotics
mvn01200  Carbon metabolism
Module
mvn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mvn_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mevan_0815
   00020 Citrate cycle (TCA cycle)
    Mevan_0815
   00620 Pyruvate metabolism
    Mevan_0815
   00640 Propanoate metabolism
    Mevan_0815
   00650 Butanoate metabolism
    Mevan_0815
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mevan_0815
   00680 Methane metabolism
    Mevan_0815
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mevan_0815
Enzymes [BR:mvn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mevan_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_9 Fer4_10 Fer4_7 Fer4_16 Fer4_8 Fer4_17 Fer4_4 CH_2 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ABR54721
JGI: Mevan0815
UniProt: A6UQE9
Position
complement(846128..846385)
Genome map
AA seq 85 aa AA seqDB search
MVNTGTIIYEPGSSANNKTGSWRVFKPILDKEKCVMCENCYIFCPEGCIQEKNGKFEIDY
DYCKGCLICERECPVKAIKAEREEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacactggaactattatttatgaaccgggaagttcggcaaacaataaaaccggg
agctggagagtatttaaacccattttggacaaagaaaaatgtgtaatgtgtgaaaattgc
tatattttctgtccagaaggctgtatccaggagaaaaatggaaaatttgaaatcgattat
gactactgtaagggatgtcttatctgtgaaagagaatgtcctgtaaaagcaataaaagct
gaaagggaagaaaaataa

DBGET integrated database retrieval system