KEGG   Methanococcus vannielii: Mevan_0959Help
Entry
Mevan_0959        CDS       T00554                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00240  Pyrimidine metabolism
mvn00250  Alanine, aspartate and glutamate metabolism
mvn01100  Metabolic pathways
Module
mvn_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mevan_0959
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mevan_0959
Enzymes [BR:mvn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mevan_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABR54862
JGI: Mevan0959
UniProt: A6UQU0
Position
complement(977810..978718)
Genome map
AA seq 302 aa AA seqDB search
MRHLISMRDIGRDDILRILEESEKMEAVLNEKGHSDILNGKILATLFYEPSTRTRLSFET
AMKRLGGNVIGFTDISNTSVTKGESLTDTIKVISGYSDLIVIRHPSEGAARLSSEVSGVP
VINAGDGSNQHPTQTLLDLYTIKREVGKIDGLKIAFIGDLKYGRTVHSLCQALSLFKNVE
LRLISPDELKIPREVLEYIDGKVLLSETSEINIEDVDVVYMTRIQKERFIDLNEYQKVKG
TYRLLKEHVLEKNLIIMHPLPRVDEIDSKVDSLNQAKYFKQSFYGVPVRMAILSLLSKDL
QK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagacatctgatttcaatgagggacatcgggcgagatgatattcttcgtattttggaa
gaatctgaaaaaatggaagctgttttaaatgaaaaggggcattctgatatattaaacggc
aaaattttagcaactcttttttatgagccgtctacaagaacgagattgtctttcgaaact
gcaatgaaaaggcttggtggaaatgttattggttttacagatatttcaaatacttcggta
acaaaaggcgagtctttaactgatactataaaagtaataagtggatacagcgatttaatt
gttatccggcacccttcagaaggtgctgcaagactttcaagtgaggtttcaggtgttcca
gtaataaatgcaggcgatggctcaaaccagcatccaacacaaacacttcttgacttatat
actataaagcgagaagttggtaaaattgacggcttaaaaattgcatttattggcgactta
aaatatggtagaactgttcattcattatgccaagcgttatctctgtttaaaaatgtggaa
ctacgccttatttctccagatgaattaaaaataccaagggaagttttagaatatattgat
ggaaaagttttactgagtgaaactagtgaaattaatattgaagatgttgatgtagtttac
atgacaagaattcaaaaagagagatttattgatttaaacgaatatcaaaaagtaaaaggt
acctacaggcttttaaaagagcacgttttggaaaaaaatttaataataatgcacccgctt
ccaagggtagatgaaatcgattcaaaagtcgatagtttaaatcaagcaaagtatttcaaa
cagtctttttacggagttccggttagaatggcgattttaagccttttatcaaaagatttg
caaaaataa

DBGET integrated database retrieval system