KEGG   Methanococcus vannielii: Mevan_1140Help
Entry
Mevan_1140        CDS       T00554                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mvn  Methanococcus vannielii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mevan_1140
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mevan_1140
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mevan_1140
Enzymes [BR:mvn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mevan_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1151148..1152362
Genome map
AA seq 404 aa AA seqDB search
MIQKCRICNKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRKRELGVWRYLDFLP
VKDPKKIVSLNEGGTPLYKCENLAKKLGLKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKELALENKLYLLNSVNPYRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETEFIEKLPRMIGIQAEGAQPIVKAIKEGLLEIIPDENPETIATAIRIGNP
VNATKALDAIRSSGGLAESVNDEEIVEAQKLLAQFEGIFVEPASASSIAGLIKLINMGLI
DKNQKIVCITTGNGLKDPDAAIKASKMPTEIECDMEVLKKAIDD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgtagaatatgtaacaaagagtatgatgtcgatgctataatttataat
tgcgaatgtggcggattacttgaaataaaatatgattttgaaagtataaaagaaaaagtt
tcaaaagaatctttaagaaaaagggaacttggcgtttggaggtacctcgactttttacct
gttaaagaccctaaaaaaatagttagcttaaatgagggtggaacaccgctttataaatgt
gaaaaccttgcgaaaaaattgggcttgaaagagttatatgttaaaaatgaaggtgcaaac
cctactggaagttttaaagatagaggaatgactgttggagttacaagagcaaatgaactc
ggtgttgaggtagtgggttgtgcttcgactggaaatacttctgcaagtcttgcagcgtac
tctgcaagggcaggtaaaaaatgcattgttttacttcctggtggaaaagtagctttagga
aaacttgcacaagcaatgttttacggcgccaaagttattcaaattaatggaaacttcgat
gaagcacttgtgatggtaaaagaactcgccttagaaaacaaactctaccttttaaattca
gtaaatccttacaggcttgaagggcaaaaaacaattggttttgagatttgcgaccagtta
gactttgaagttccggacatggtcattttacccgttggaaatgcaggaaacattagtgca
atctggaaaggctttaaagaatttaaggaaacagaatttattgaaaaattaccaagaatg
attggaattcaagcagaaggggcacaaccaattgtaaaagcgattaaagaaggacttctt
gaaataattcctgatgaaaaccctgaaacaatagcaactgcaataagaattggaaatccg
gtaaacgctacaaaagcactcgatgcaataaggtcgtcaggaggccttgcagaaagcgta
aacgatgaagaaatagttgaggcacaaaagcttttagcacaatttgaaggaatttttgtt
gaacctgcatctgcttcatcaattgcagggcttatcaagttaataaacatgggattaatt
gataaaaaccaaaaaattgtatgtattacaactggaaacggtttaaaagaccctgatgca
gcgataaaagcaagtaaaatgccaaccgaaattgaatgtgatatggaagttttgaaaaaa
gcaatagatgattaa

DBGET integrated database retrieval system