KEGG   Methanococcus vannielii: Mevan_1140Help
Entry
Mevan_1140        CDS       T00554                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mvn  Methanococcus vannielii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mevan_1140
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mevan_1140
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mevan_1140
Enzymes [BR:mvn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mevan_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1151148..1152362
Genome map
AA seq 404 aa AA seqDB search
MIQKCRICNKEYDVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRKRELGVWRYLDFLP
VKDPKKIVSLNEGGTPLYKCENLAKKLGLKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKELALENKLYLLNSVNPYRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETEFIEKLPRMIGIQAEGAQPIVKAIKEGLLEIIPDENPETIATAIRIGNP
VNATKALDAIRSSGGLAESVNDEEIVEAQKLLAQFEGIFVEPASASSIAGLIKLINMGLI
DKNQKIVCITTGNGLKDPDAAIKASKMPTEIECDMEVLKKAIDD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgtagaatatgtaacaaagagtatgatgtcgatgctataatttataat
tgcgaatgtggcggattacttgaaataaaatatgattttgaaagtataaaagaaaaagtt
tcaaaagaatctttaagaaaaagggaacttggcgtttggaggtacctcgactttttacct
gttaaagaccctaaaaaaatagttagcttaaatgagggtggaacaccgctttataaatgt
gaaaaccttgcgaaaaaattgggcttgaaagagttatatgttaaaaatgaaggtgcaaac
cctactggaagttttaaagatagaggaatgactgttggagttacaagagcaaatgaactc
ggtgttgaggtagtgggttgtgcttcgactggaaatacttctgcaagtcttgcagcgtac
tctgcaagggcaggtaaaaaatgcattgttttacttcctggtggaaaagtagctttagga
aaacttgcacaagcaatgttttacggcgccaaagttattcaaattaatggaaacttcgat
gaagcacttgtgatggtaaaagaactcgccttagaaaacaaactctaccttttaaattca
gtaaatccttacaggcttgaagggcaaaaaacaattggttttgagatttgcgaccagtta
gactttgaagttccggacatggtcattttacccgttggaaatgcaggaaacattagtgca
atctggaaaggctttaaagaatttaaggaaacagaatttattgaaaaattaccaagaatg
attggaattcaagcagaaggggcacaaccaattgtaaaagcgattaaagaaggacttctt
gaaataattcctgatgaaaaccctgaaacaatagcaactgcaataagaattggaaatccg
gtaaacgctacaaaagcactcgatgcaataaggtcgtcaggaggccttgcagaaagcgta
aacgatgaagaaatagttgaggcacaaaagcttttagcacaatttgaaggaatttttgtt
gaacctgcatctgcttcatcaattgcagggcttatcaagttaataaacatgggattaatt
gataaaaaccaaaaaattgtatgtattacaactggaaacggtttaaaagaccctgatgca
gcgataaaagcaagtaaaatgccaaccgaaattgaatgtgatatggaagttttgaaaaaa
gcaatagatgattaa

DBGET integrated database retrieval system