KEGG   Methanococcus vannielii: Mevan_1304Help
Entry
Mevan_1304        CDS       T00554                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mvn  Methanococcus vannielii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mevan_1304
   01230 Biosynthesis of amino acids
    Mevan_1304
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mevan_1304
   00030 Pentose phosphate pathway
    Mevan_1304
   00051 Fructose and mannose metabolism
    Mevan_1304
  Energy metabolism
   00680 Methane metabolism
    Mevan_1304
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mevan_1304
Enzymes [BR:mvn01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mevan_1304
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mevan_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1329687..1330613)
Genome map
AA seq 308 aa AA seqDB search
MIKKLKNTDIIVPLETPKSMYDEYIKNYLEITKNTGKLMLFAGDQKIEHLNDDFYGENIS
IDDSDPEHLFKIAANSKIGVFAAQLGLISRYGRDYSGVNYLVKLNSKTNIVETEQKDPLS
CALLSVADVLEFKQNSGLNILGIGYTIYLGSEFESIMLSEASKIIYEAHKNGFVVVLWVY
PRGKAVKNEKDPHLIAGAAGVASCLGADFVKVNYPKGENPEILFKEVVMASGRTKVVCAG
GGSKSPEEFLKELYNQIHVSGAFGNATGRNIHQKPLNEAVNMCNAIYAITIEDKSVEEAL
KIYNGNMK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaattaaaaaatacggatataatagttcccttggaaaccccaaaatccatg
tatgacgaatatataaaaaattaccttgaaattaccaaaaataccggtaaattaatgctt
tttgcgggagaccaaaaaattgagcaccttaatgacgatttttacggcgaaaatatttca
atagatgattcagaccctgagcatttattcaaaattgcagctaattctaaaatcggagta
tttgcagcacagcttggattaatatctcgctatggaagagattacagtggtgtaaactat
cttgttaaattaaattctaaaactaatatcgtagaaactgagcaaaaagaccctttaagc
tgtgctttattaagtgtagccgatgttttagagtttaaacagaattctggactgaatata
cttggaatagggtatacaatataccttggaagtgaattcgagtcaataatgctttctgaa
gcttcaaaaataatatacgaagcccataaaaatggctttgtagttgtactctgggtttat
ccaaggggaaaagccgttaaaaatgaaaaagacccccatttaattgcaggggccgcagga
gttgcttcatgccttggagcagattttgtaaaggtaaattatcctaaaggggaaaatcct
gaaatattatttaaagaagtagttatggcctcaggaagaacaaaagtagtatgtgcaggt
ggaggaagtaaaagtcctgaagaatttttaaaggagctttataaccaaatccatgtttca
ggagcgtttggaaatgctactggccgtaatatacatcaaaaaccattaaatgaagcagta
aatatgtgtaatgcaatttatgcaataactattgaagataaatctgttgaagaagcttta
aaaatatataacgggaatatgaagtaa

DBGET integrated database retrieval system