KEGG   Methanococcus vannielii: Mevan_1304Help
Entry
Mevan_1304        CDS       T00554                                 

Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00010  Glycolysis / Gluconeogenesis
mvn00030  Pentose phosphate pathway
mvn00051  Fructose and mannose metabolism
mvn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mvn00680  Methane metabolism
mvn01100  Metabolic pathways
mvn01110  Biosynthesis of secondary metabolites
mvn01120  Microbial metabolism in diverse environments
mvn01130  Biosynthesis of antibiotics
mvn01200  Carbon metabolism
mvn01230  Biosynthesis of amino acids
Module
mvn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mevan_1304
   00030 Pentose phosphate pathway
    Mevan_1304
   00051 Fructose and mannose metabolism
    Mevan_1304
  Energy metabolism
   00680 Methane metabolism
    Mevan_1304
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mevan_1304
Enzymes [BR:mvn01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mevan_1304
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mevan_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: ABR55201
JGI: Mevan1304
UniProt: A6URS9
Position
complement(1329687..1330613)
Genome map
AA seq 308 aa AA seqDB search
MIKKLKNTDIIVPLETPKSMYDEYIKNYLEITKNTGKLMLFAGDQKIEHLNDDFYGENIS
IDDSDPEHLFKIAANSKIGVFAAQLGLISRYGRDYSGVNYLVKLNSKTNIVETEQKDPLS
CALLSVADVLEFKQNSGLNILGIGYTIYLGSEFESIMLSEASKIIYEAHKNGFVVVLWVY
PRGKAVKNEKDPHLIAGAAGVASCLGADFVKVNYPKGENPEILFKEVVMASGRTKVVCAG
GGSKSPEEFLKELYNQIHVSGAFGNATGRNIHQKPLNEAVNMCNAIYAITIEDKSVEEAL
KIYNGNMK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaattaaaaaatacggatataatagttcccttggaaaccccaaaatccatg
tatgacgaatatataaaaaattaccttgaaattaccaaaaataccggtaaattaatgctt
tttgcgggagaccaaaaaattgagcaccttaatgacgatttttacggcgaaaatatttca
atagatgattcagaccctgagcatttattcaaaattgcagctaattctaaaatcggagta
tttgcagcacagcttggattaatatctcgctatggaagagattacagtggtgtaaactat
cttgttaaattaaattctaaaactaatatcgtagaaactgagcaaaaagaccctttaagc
tgtgctttattaagtgtagccgatgttttagagtttaaacagaattctggactgaatata
cttggaatagggtatacaatataccttggaagtgaattcgagtcaataatgctttctgaa
gcttcaaaaataatatacgaagcccataaaaatggctttgtagttgtactctgggtttat
ccaaggggaaaagccgttaaaaatgaaaaagacccccatttaattgcaggggccgcagga
gttgcttcatgccttggagcagattttgtaaaggtaaattatcctaaaggggaaaatcct
gaaatattatttaaagaagtagttatggcctcaggaagaacaaaagtagtatgtgcaggt
ggaggaagtaaaagtcctgaagaatttttaaaggagctttataaccaaatccatgtttca
ggagcgtttggaaatgctactggccgtaatatacatcaaaaaccattaaatgaagcagta
aatatgtgtaatgcaatttatgcaataactattgaagataaatctgttgaagaagcttta
aaaatatataacgggaatatgaagtaa

DBGET integrated database retrieval system