KEGG   Methanococcus vannielii: Mevan_1328Help
Entry
Mevan_1328        CDS       T00554                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mvn  Methanococcus vannielii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mevan_1328
   01230 Biosynthesis of amino acids
    Mevan_1328
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mevan_1328
   00030 Pentose phosphate pathway
    Mevan_1328
   00051 Fructose and mannose metabolism
    Mevan_1328
  Energy metabolism
   00680 Methane metabolism
    Mevan_1328
Enzymes [BR:mvn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mevan_1328
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mevan_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1353405..1354556
Genome map
AA seq 383 aa AA seqDB search
MQEKITMSVIKADVGGLCGHTLAPEELLDAAEYVLENALDEILIDYYVTNCGDDIDLIMT
HNKGTDSEEVHKLAWDAFEEATSVAKELKLYGAGQDLLSNSFSGNIKGLGPGCAEMEFVE
RPSEPVIVFCCDKTDPAAFNLPFYKMFSDPFSTAGLVYDPSMASGFRYEVLDVMEHKRVF
MDTPEETYSLLALIGNTEKYAIKRVYRRKDNEITAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEILEPFANPHLVAGWMRGCHFGPIMPVAEEDARPARFDGPARVMALGFQLS
KGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPETMMEYTSVPKVLAQLKG
RFIDIDENCGCKIDQIRNRGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaataaccatgagcgttattaaagcagatgtgggggggctttgtggccac
acacttgctccagaagagttactcgatgctgcagagtatgttttagaaaatgcactagat
gaaattttaattgattattatgttacaaactgtggtgacgacatagatttgataatgacc
cacaataaaggaacagatagcgaagaagtacataaacttgcatgggatgcatttgaagaa
gcaacaagcgttgcaaaagaattaaaactttacggtgcaggtcaggacttactttcaaac
tctttttccggaaacatcaaaggacttggccccggctgtgctgaaatggaatttgtcgaa
agaccaagtgaaccagttattgtattttgctgtgacaaaactgacccagcagcatttaat
ttgccattttataaaatgttttcagacccatttagtactgcaggtttagtttatgaccct
tcaatggcatcagggtttaggtatgaagtattggatgtaatggagcacaaaagggttttc
atggacacgcctgaggaaacatattctttacttgcattgatcggaaacaccgaaaaatac
gccataaaaagagtttacaggagaaaagataacgaaattacggcagtatgttcatcagaa
aaattgaatatgattgcaggagaatacgttggaaaagatgaccctgttgcaattgtaagg
gctcaaagtggatttcctgcagtaggggaaattttagaaccctttgcaaacccacactta
gttgcaggatggatgagaggatgccattttggccctataatgccagttgctgaagaagat
gcaagacctgcaagatttgacggccctgcaagagttatggctttaggattccagctatca
aaaggaagactagttggaccaaatgatttatttgcagacaaatcatttgataaggcaagg
gaaaaagcactcgatatggcagaaatgatgaggtcaatgggcccatttatgcctcataga
ttacctgaaactatgatggaatacacgtcagttccaaaagttttagctcaattaaaagga
agatttattgatattgatgaaaattgcggatgtaaaatcgaccagataagaaacagagga
gatatggaataa

DBGET integrated database retrieval system