KEGG   Methanococcus vannielii: Mevan_1338Help
Entry
Mevan_1338        CDS       T00554                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mvn  Methanococcus vannielii
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mvn00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1365285..1366802
Genome map
AA seq 505 aa AA seqDB search
MLFLNAKFIDLDLGANAVIVNEEDLKGTSYYPQDRVLIESHSGSVLGILYSTKTMVQKGE
VGIPVRKMKGISLKEGEEVNLRHAEKPESIQFIKKKMDGQVLSPNEIRTIIDEIVSKKLS
NIELAAFVTSTYVNGMNMEEIVEMTKRMAETGDMISWEKSLVVDIHSIGGVPGNKYALLS
IPILAAAGITIPKTSSRAITSPAGTADVMEVLTNVELDEEELKRVVKATNGCLVWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKVATGIKYAVIDIPVGKGVKIKNEAEGAKL
ARKFIELGELLNIRVECVLTYGGQPLGRAIGPALEAKEALEALTDPKSAPKSLIEKAISL
AGILLELGGSAQIGDGQKLAWEILESGRALEKFNQIIVEQGGTPKKPEEIELGKYVEEVR
SPIDGYIVGINNTSITNVVKEAGAPRDKKAGLLLNAKIGNKVKRGDILYTIYSGSEERLN
SAVNLARRVYPVNVEGMMIERISKF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttttgaatgcaaagtttatagatctcgatttaggtgcaaatgcggttatcgta
aatgaagaggatttgaagggaacctcctactaccctcaagaccgggttttgatagaatca
cacagcggttctgttttaggaatactttattcaactaaaactatggttcaaaaaggtgaa
gttggaatacctgtgcgtaaaatgaaaggtatttctttaaaagagggtgaagaagtaaat
ttaaggcatgctgaaaaacccgaatcaattcaatttataaagaaaaaaatggatggccaa
gtgctttctccaaatgaaataaggacaataattgatgaaatagtctcaaaaaagctttca
aatatcgaacttgcagcatttgttacgtcaacatatgtaaacggaatgaatatggaagaa
attgtcgaaatgacaaaaagaatggctgaaactggggacatgatttcatgggaaaaaagt
cttgttgtagatattcacagtatcggcggagttcctggaaataagtatgcacttctttca
attccaattcttgcagccgcaggaattacaattccaaaaacatcttcaagagcaattacg
tcaccagcaggtactgctgacgttatggaagttttaacaaatgtagagctagatgaggaa
gaattaaaaagagttgtaaaagcaacaaacggctgtttggtatggggtggaggagttaac
ttagcacctgcagatgacattataatcaatgttgaaagacctgtttcaatagatcctcaa
ccacaacttcttgcaagtgtaatggctaaaaaagttgcaacgggtattaaatacgcagta
atagatattcccgttggaaaaggcgttaaaattaaaaatgaagcagaaggtgctaaatta
gcaagaaaattcattgaattaggagaattattaaatatccgagttgaatgtgttttaact
tatgggggacaaccattaggacgtgcaatcgggccggcattagaggcaaaagaagccttg
gaagcattaactgatccaaaaagtgcaccaaaaagtttaattgaaaaagccatatcctta
gcaggaatactgcttgaacttggtggttcagcacaaattggggatggacaaaagttagca
tgggaaatacttgaatcaggacgcgcacttgaaaaattcaaccagattatagtcgaacaa
ggtgggactccgaaaaaaccggaggaaattgaacttggaaaatatgttgaagaagttcgt
tccccaattgacggctacattgtagggataaataatacttcaataacaaacgttgtaaaa
gaagctggggctccaagggataaaaaagcaggtcttcttttaaatgcaaaaattggaaat
aaggtaaaacgtggtgacatattatacacgatatattcaggctctgaagagagattaaat
tcagcagttaatcttgcaagaagggtttacccggtaaatgttgaaggaatgatgattgaa
agaataagtaaattttaa

DBGET integrated database retrieval system