KEGG   Methanococcus vannielii: Mevan_1505Help
Entry
Mevan_1505        CDS       T00554                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mvn  Methanococcus vannielii
Pathway
mvn00010  Glycolysis / Gluconeogenesis
mvn00051  Fructose and mannose metabolism
mvn01100  Metabolic pathways
mvn01110  Biosynthesis of secondary metabolites
mvn01120  Microbial metabolism in diverse environments
mvn01130  Biosynthesis of antibiotics
mvn01200  Carbon metabolism
mvn01230  Biosynthesis of amino acids
Module
mvn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mvn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mevan_1505
   00051 Fructose and mannose metabolism
    Mevan_1505
   00562 Inositol phosphate metabolism
    Mevan_1505
Enzymes [BR:mvn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mevan_1505
Exosome [BR:mvn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mevan_1505
  Exosomal proteins of bladder cancer cells
   Mevan_1505
  Exosomal proteins of melanoma cells
   Mevan_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABR55399
JGI: Mevan1505
UniProt: A6USC7
Position
complement(1523224..1523877)
Genome map
AA seq 217 aa AA seqDB search
MIINYKTYSESTGKNGLKIAKAAEKVSDESGITIAVAPQFLDLKTILNEVSIPVYAQHMD
PVVSGSSTGHISSESLKDAGVFGTLLNHSEKRMQLFDIEKCIEISNKLDLKTVVCTNNIP
VSKAVSALNPTSIAVEPPELIGSGIPVSKANPEIVSGTVLEVRSINKSVEILCGAGISKG
EDLKAAIELGTNGVLLASGIVRAKNVEDAIRELITKI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
attataataaattataaaacatattctgaaagcactggaaaaaacggcttaaaaattgca
aaagctgcagaaaaagtatcagatgaatctggaatcactattgctgtagcacctcagttt
ttagatttaaaaacgattttaaacgaagtaagtattccagtatatgctcaacacatggat
ccagtagtttctggaagtagtactggacatatatcctcagaatcattaaaagatgccggt
gtttttggaacccttttaaaccattctgaaaaaagaatgcaactttttgacattgaaaag
tgtatagaaatttcaaataaacttgatttaaaaacggttgtatgtacaaataatatccct
gtttcaaaagctgtttctgcattaaatccaacttcaattgcagttgaacctccagaatta
attgggagcggaattcctgtttcaaaagcaaaccccgaaatagtatcaggtactgtttta
gaagttcggagcataaataaaagcgttgaaattctttgtggtgcaggaatatctaaaggt
gaagatttaaaagctgcaatcgaacttggaacaaacggtgttttacttgcatcgggaatt
gtaagggctaaaaacgtggaagacgcaatcagagaattaattactaaaatttaa

DBGET integrated database retrieval system