KEGG   Methanococcus vannielii: Mevan_1580Help
Entry
Mevan_1580        CDS       T00554                                 

Definition
alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mvn  Methanococcus vannielii
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mvn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1595367..1596245
Genome map
AA seq 292 aa AA seqDB search
MKMGIISEERDWVTDELKSKMEKNDIDPVFIQPSKIVSSIASDVKFEHNNRNITDLECAF
IRNIGDGVEMFHRFDTLKYLENYVPIINPMDGIENAGNKFRTSFLMEVNKIPHPKTIISE
DVNKALIAAEKFEDVVLKPLFGSQGRGLVRVKGRSTVAKLKALNTFKSNNGVIYLQEFVT
NPNNVYRDIRAFAVGDKVVSAMYRKSDSWITNIHQNGVAEKCEVSEELSKLVLAAKDALG
LVYAGVDVMESSDGLKVIEVNACPSWEGLSRVSDTNITQYIIDAAIEYSKRC
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgggaataatttccgaagaacgagactgggttactgatgaattaaaaagcaag
atggaaaaaaatgatattgacccagtttttattcagccctcaaagatagtttcatcgatt
gcgtctgacgtaaaatttgaacataataaccgaaacattactgatttagagtgtgcattt
attaggaatatcggtgacggcgtagagatgtttcacaggtttgacacgctaaaatatctt
gaaaattacgttccaataataaatccaatggacggtattgaaaatgcaggaaataaattt
agaacttcttttttaatggaggtaaataagataccccatccaaaaacgattatttctgaa
gacgtaaataaagcgttaattgctgctgaaaaatttgaagatgttgtactaaaacctctt
tttggaagtcagggacgaggacttgtacgggttaagggtaggtctaccgttgctaaatta
aaagctttaaacacctttaaaagtaataatggggtaatttatcttcaggaatttgtaaca
aatccaaataatgtttatagggatataagggcatttgctgttggagataaagtagtttca
gcaatgtatcgaaagtcagacagctggattaccaatattcatcaaaacggggttgcagaa
aagtgtgaagtatctgaagaattaagtaaactcgttttagctgcaaaagatgcacttgga
ctcgtttatgcaggagttgatgttatggaaagttctgacggtttaaaagtaattgaagta
aatgcatgcccttcatgggaaggactttcaagagtttccgatacaaacattactcagtat
attattgatgctgcaattgaatattctaaacgatgttaa

DBGET integrated database retrieval system