KEGG   Methanococcus vannielii: Mevan_1580Help
Entry
Mevan_1580        CDS       T00554                                 

Definition
alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mvn  Methanococcus vannielii
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mevan_1580
Enzymes [BR:mvn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Mevan_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1595367..1596245
Genome map
AA seq 292 aa AA seqDB search
MKMGIISEERDWVTDELKSKMEKNDIDPVFIQPSKIVSSIASDVKFEHNNRNITDLECAF
IRNIGDGVEMFHRFDTLKYLENYVPIINPMDGIENAGNKFRTSFLMEVNKIPHPKTIISE
DVNKALIAAEKFEDVVLKPLFGSQGRGLVRVKGRSTVAKLKALNTFKSNNGVIYLQEFVT
NPNNVYRDIRAFAVGDKVVSAMYRKSDSWITNIHQNGVAEKCEVSEELSKLVLAAKDALG
LVYAGVDVMESSDGLKVIEVNACPSWEGLSRVSDTNITQYIIDAAIEYSKRC
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgggaataatttccgaagaacgagactgggttactgatgaattaaaaagcaag
atggaaaaaaatgatattgacccagtttttattcagccctcaaagatagtttcatcgatt
gcgtctgacgtaaaatttgaacataataaccgaaacattactgatttagagtgtgcattt
attaggaatatcggtgacggcgtagagatgtttcacaggtttgacacgctaaaatatctt
gaaaattacgttccaataataaatccaatggacggtattgaaaatgcaggaaataaattt
agaacttcttttttaatggaggtaaataagataccccatccaaaaacgattatttctgaa
gacgtaaataaagcgttaattgctgctgaaaaatttgaagatgttgtactaaaacctctt
tttggaagtcagggacgaggacttgtacgggttaagggtaggtctaccgttgctaaatta
aaagctttaaacacctttaaaagtaataatggggtaatttatcttcaggaatttgtaaca
aatccaaataatgtttatagggatataagggcatttgctgttggagataaagtagtttca
gcaatgtatcgaaagtcagacagctggattaccaatattcatcaaaacggggttgcagaa
aagtgtgaagtatctgaagaattaagtaaactcgttttagctgcaaaagatgcacttgga
ctcgtttatgcaggagttgatgttatggaaagttctgacggtttaaaagtaattgaagta
aatgcatgcccttcatgggaaggactttcaagagtttccgatacaaacattactcagtat
attattgatgctgcaattgaatattctaaacgatgttaa

DBGET integrated database retrieval system