KEGG   Methanococcus voltae: Mvol_0278Help
Entry
Mvol_0278         CDS       T01251                                 

Definition
RimK family alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mvo  Methanococcus voltae
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mvo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
304006..304920
Genome map
AA seq 304 aa AA seqDB search
MKMGIISEERDWITDELKNKMEQNDIDPIIIKPSKIVNTLSKKGIKFEHNSRNLFDLECA
FVRDIGFGEEMMHRFDIIECLSTYIPIINPPQAIQDAGNKYRTSFLLSRNEIPQSETIVS
EDINKILAYSDKFDDSVLKPFFGNGGQGLVRLKGRSTVAKLNILNTFKETNPAFYMQKFI
NNPNNVYRDIRAFVIGDRVVSAMYRESDNWITNIKQNGTPKQCEITREITKLALAAKEAL
GLYYAGVDLIESETGLKVIEVNACPSWEGLSKVSEEDITQLLINEANRIVKKHRMDKLTE
KYIN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgggtattatctcagaggaaagagattggataactgacgaattaaaaaataaa
atggagcaaaacgatatcgacccgataatcataaagccatccaaaattgttaatacgttg
tcaaaaaaaggcataaaattcgaacacaatagtagaaatttgttcgatttagaatgtgca
tttgtacgggatatcggatttggtgaagaaatgatgcacagatttgatataatcgagtgt
ttaagtacttatattccgataataaacccaccgcaagcaatacaagatgcaggtaataaa
tatagaacctcttttttgttatcaagaaacgagattccacaatctgagacaatcgtttca
gaagatattaataaaatattggcttattctgacaaatttgacgatagtgtcttaaaacca
ttttttggaaatggcgggcaaggattagtcagattaaaaggtaggtcaacagttgcaaag
ctaaatatcttaaatacttttaaagagacaaaccctgcattttatatgcaaaaattcata
aataaccctaataatgtatatagggatattagagcttttgtaataggagatagggtagtt
tctgctatgtacagggaatcagacaactggattacaaatattaagcaaaatggaactcca
aaacagtgtgaaataacccgagagataactaagttagcattggctgcaaaagaagcactc
ggtttatattatgcaggtgtagatttaatagaaagtgaaacagggttaaaagtaattgaa
gttaacgcttgtccttcgtgggaaggtctttctaaagtttccgaggaagatattacgcaa
ttattaatcaatgaagcaaatagaattgttaaaaaacatagaatggataaattaacagaa
aaatatattaattaa

DBGET integrated database retrieval system