KEGG   Methanococcus voltae: Mvol_0278Help
Entry
Mvol_0278         CDS       T01251                                 

Definition
RimK family alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mvo  Methanococcus voltae
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mvol_0278
Enzymes [BR:mvo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Mvol_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
304006..304920
Genome map
AA seq 304 aa AA seqDB search
MKMGIISEERDWITDELKNKMEQNDIDPIIIKPSKIVNTLSKKGIKFEHNSRNLFDLECA
FVRDIGFGEEMMHRFDIIECLSTYIPIINPPQAIQDAGNKYRTSFLLSRNEIPQSETIVS
EDINKILAYSDKFDDSVLKPFFGNGGQGLVRLKGRSTVAKLNILNTFKETNPAFYMQKFI
NNPNNVYRDIRAFVIGDRVVSAMYRESDNWITNIKQNGTPKQCEITREITKLALAAKEAL
GLYYAGVDLIESETGLKVIEVNACPSWEGLSKVSEEDITQLLINEANRIVKKHRMDKLTE
KYIN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgggtattatctcagaggaaagagattggataactgacgaattaaaaaataaa
atggagcaaaacgatatcgacccgataatcataaagccatccaaaattgttaatacgttg
tcaaaaaaaggcataaaattcgaacacaatagtagaaatttgttcgatttagaatgtgca
tttgtacgggatatcggatttggtgaagaaatgatgcacagatttgatataatcgagtgt
ttaagtacttatattccgataataaacccaccgcaagcaatacaagatgcaggtaataaa
tatagaacctcttttttgttatcaagaaacgagattccacaatctgagacaatcgtttca
gaagatattaataaaatattggcttattctgacaaatttgacgatagtgtcttaaaacca
ttttttggaaatggcgggcaaggattagtcagattaaaaggtaggtcaacagttgcaaag
ctaaatatcttaaatacttttaaagagacaaaccctgcattttatatgcaaaaattcata
aataaccctaataatgtatatagggatattagagcttttgtaataggagatagggtagtt
tctgctatgtacagggaatcagacaactggattacaaatattaagcaaaatggaactcca
aaacagtgtgaaataacccgagagataactaagttagcattggctgcaaaagaagcactc
ggtttatattatgcaggtgtagatttaatagaaagtgaaacagggttaaaagtaattgaa
gttaacgcttgtccttcgtgggaaggtctttctaaagtttccgaggaagatattacgcaa
ttattaatcaatgaagcaaatagaattgttaaaaaacatagaatggataaattaacagaa
aaatatattaattaa

DBGET integrated database retrieval system