KEGG   Methanococcus voltae: Mvol_0366Help
Entry
Mvol_0366         CDS       T01251                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mvo  Methanococcus voltae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvol_0366
   01230 Biosynthesis of amino acids
    Mvol_0366
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvol_0366
   00051 Fructose and mannose metabolism
    Mvol_0366
   00562 Inositol phosphate metabolism
    Mvol_0366
Enzymes [BR:mvo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mvol_0366
Exosome [BR:mvo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mvol_0366
  Exosomal proteins of bladder cancer cells
   Mvol_0366
  Exosomal proteins of melanoma cells
   Mvol_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
399249..399917
Genome map
AA seq 222 aa AA seqDB search
MIKPVVIINYKTYMESISDKGLNIAKCAEKVSEESGIEISVAPQFTDLKTIVEQTNVKVY
SQHMDAIKPGSNTGKILPEAVKSTGAFGTLINHSEKRLLLSDIEEIINKSKELKLESVVC
TNNIGVSKAVSALSPDYIAVEPPELIGSGIPVSKANPEVVEGTVSAVHDINKDVKVLCGA
GISKGEDVKSALELGAEGVLLASGVVKAKDVEQSIRDLISEL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
attattaaaccagttgttataattaattacaagacatatatggaaagtattagcgataaa
ggactaaatatagcaaaatgtgcggaaaaagtcagtgaagagagcggtatagagatttct
gtagcccctcagttcacagatttaaaaacaatcgtagagcaaactaatgtaaaagtttac
tctcaacatatggatgcgataaaaccaggtagcaacaccggtaaaattttgcccgaggct
gtaaaaagtactggtgcgttcggaacacttataaaccattctgaaaagcgtttattactt
tcagacattgaagaaatcataaataaatcaaaagagctaaaacttgaaagtgtagtttgt
acaaataatatcggcgtttcgaaagctgtttcggcattatcgcctgactacattgcagtt
gaaccacctgaattaataggttcaggtattccggtttcaaaagctaaccctgaagttgta
gaaggaacggttagtgcagtgcacgatattaacaaagatgtgaaagtactctgtggtgca
ggtatttctaaaggggaagacgttaaatcagcattagaactcggagcagaaggtgttttg
cttgcttcgggtgtagtaaaagcaaaagacgttgaacagtcaattagggatttaataagc
gaattataa

DBGET integrated database retrieval system