KEGG   Methanococcus voltae: Mvol_0366Help
Entry
Mvol_0366         CDS       T01251                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mvo  Methanococcus voltae
Pathway
mvo00010  Glycolysis / Gluconeogenesis
mvo00051  Fructose and mannose metabolism
mvo01100  Metabolic pathways
mvo01110  Biosynthesis of secondary metabolites
mvo01120  Microbial metabolism in diverse environments
mvo01130  Biosynthesis of antibiotics
mvo01200  Carbon metabolism
mvo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvol_0366
   00051 Fructose and mannose metabolism
    Mvol_0366
   00562 Inositol phosphate metabolism
    Mvol_0366
Enzymes [BR:mvo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mvol_0366
Exosome [BR:mvo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mvol_0366
  Exosomal proteins of bladder cancer cells
   Mvol_0366
  Exosomal proteins of melanoma cells
   Mvol_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh NMO His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: ADI36026
JGI: Mvol_0366
UniProt: D7DSB6
Position
399249..399917
Genome map
AA seq 222 aa AA seqDB search
MIKPVVIINYKTYMESISDKGLNIAKCAEKVSEESGIEISVAPQFTDLKTIVEQTNVKVY
SQHMDAIKPGSNTGKILPEAVKSTGAFGTLINHSEKRLLLSDIEEIINKSKELKLESVVC
TNNIGVSKAVSALSPDYIAVEPPELIGSGIPVSKANPEVVEGTVSAVHDINKDVKVLCGA
GISKGEDVKSALELGAEGVLLASGVVKAKDVEQSIRDLISEL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
attattaaaccagttgttataattaattacaagacatatatggaaagtattagcgataaa
ggactaaatatagcaaaatgtgcggaaaaagtcagtgaagagagcggtatagagatttct
gtagcccctcagttcacagatttaaaaacaatcgtagagcaaactaatgtaaaagtttac
tctcaacatatggatgcgataaaaccaggtagcaacaccggtaaaattttgcccgaggct
gtaaaaagtactggtgcgttcggaacacttataaaccattctgaaaagcgtttattactt
tcagacattgaagaaatcataaataaatcaaaagagctaaaacttgaaagtgtagtttgt
acaaataatatcggcgtttcgaaagctgtttcggcattatcgcctgactacattgcagtt
gaaccacctgaattaataggttcaggtattccggtttcaaaagctaaccctgaagttgta
gaaggaacggttagtgcagtgcacgatattaacaaagatgtgaaagtactctgtggtgca
ggtatttctaaaggggaagacgttaaatcagcattagaactcggagcagaaggtgttttg
cttgcttcgggtgtagtaaaagcaaaagacgttgaacagtcaattagggatttaataagc
gaattataa

DBGET integrated database retrieval system