KEGG   Methanococcus voltae: Mvol_0366Help
Entry
Mvol_0366         CDS       T01251                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mvo  Methanococcus voltae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mvo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mvo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mvo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mvo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
399249..399917
Genome map
AA seq 222 aa AA seqDB search
MIKPVVIINYKTYMESISDKGLNIAKCAEKVSEESGIEISVAPQFTDLKTIVEQTNVKVY
SQHMDAIKPGSNTGKILPEAVKSTGAFGTLINHSEKRLLLSDIEEIINKSKELKLESVVC
TNNIGVSKAVSALSPDYIAVEPPELIGSGIPVSKANPEVVEGTVSAVHDINKDVKVLCGA
GISKGEDVKSALELGAEGVLLASGVVKAKDVEQSIRDLISEL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
attattaaaccagttgttataattaattacaagacatatatggaaagtattagcgataaa
ggactaaatatagcaaaatgtgcggaaaaagtcagtgaagagagcggtatagagatttct
gtagcccctcagttcacagatttaaaaacaatcgtagagcaaactaatgtaaaagtttac
tctcaacatatggatgcgataaaaccaggtagcaacaccggtaaaattttgcccgaggct
gtaaaaagtactggtgcgttcggaacacttataaaccattctgaaaagcgtttattactt
tcagacattgaagaaatcataaataaatcaaaagagctaaaacttgaaagtgtagtttgt
acaaataatatcggcgtttcgaaagctgtttcggcattatcgcctgactacattgcagtt
gaaccacctgaattaataggttcaggtattccggtttcaaaagctaaccctgaagttgta
gaaggaacggttagtgcagtgcacgatattaacaaagatgtgaaagtactctgtggtgca
ggtatttctaaaggggaagacgttaaatcagcattagaactcggagcagaaggtgttttg
cttgcttcgggtgtagtaaaagcaaaagacgttgaacagtcaattagggatttaataagc
gaattataa

DBGET integrated database retrieval system